Mouse anti-Human ACOX2 Monoclonal Antibody | anti-ACOX2 antibody

ACOX2 (Acyl-Coenzyme A Oxidase 2, Branched Chain, BCOX, BRCACOX, BRCOX, THCCox, Peroxisomal Branched Chain Acyl-CoA Oxidase, THCA-CoA Oxidase, Trihydroxycoprostanoyl-CoA Oxidase) (AP)

Cat. Num. AAA6129843

• Gene Names: ACOX2; BCOX; BRCOX; CBAS6; THCCox; BRCACOX
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACOX2; Monoclonal Antibody; ACOX2 (Acyl-Coenzyme A Oxidase 2; Branched Chain; BCOX; BRCACOX; BRCOX; THCCox; Peroxisomal Branched Chain Acyl-CoA Oxidase; THCA-CoA Oxidase; Trihydroxycoprostanoyl-CoA Oxidase) (AP); anti-ACOX2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D1
• Specificity: Recognizes human ACOX2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 681

• Applicable Applications for anti-ACOX2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa582-682 from ACOX2 (NP_003491) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of ACOX2 expression in transfected 293T cell line by ACOX2 monoclonal antibody Lane 1: ACOX2 transfected lysate (77kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ACOX2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-ACOX2 antibody

ACOX2 belongs to the acyl-CoA oxidases family. It is a branched-chain acyl-CoA oxidase, and is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. It oxidizes the CoA esters of the bile acid intermediates di- and tri-hydroxycholestanoic acids. Mutations resulting in the deficiency of ACOX2 lead to the accumulation of branched fatty acids and bile acid intermediates.

Product Categories/Family for anti-ACOX2 antibody

Antibodies; Enzymes; Oxidase

NCBI and Uniprot Product Information

• NCBI GI #: 4501869
• NCBI GeneID: 8309
• NCBI Accession #: NP_003491
• NCBI GenBank Nucleotide #: NM_003500
• UniProt Accession #: Q99424
• NCBI Official Full Name: peroxisomal acyl-coenzyme A oxidase 2
• NCBI Official Synonym Full Names: acyl-CoA oxidase 2
• NCBI Official Symbol: ACOX2
• NCBI Official Synonym Symbols: BCOX; BRCOX; CBAS6; THCCox; BRCACOX
• NCBI Protein Information: peroxisomal acyl-coenzyme A oxidase 2
• UniProt Protein Name: Peroxisomal acyl-coenzyme A oxidase 2
• Protein Family: Peroxisomal acyl-coenzyme A oxidase
• UniProt Gene Name: ACOX2
• UniProt Entry Name: ACOX2_HUMAN

NCBI Description

The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe cognitive disability, and death in children. [provided by RefSeq, Mar 2009]