Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human ACOX2 Monoclonal Antibody | anti-ACOX2 antibody

ACOX2 (Acyl-Coenzyme A Oxidase 2, Branched Chain, BCOX, BRCACOX, BRCOX, THCCox, Peroxisomal Branched Chain Acyl-CoA Oxidase, THCA-CoA Oxidase, Trihydroxycoprostanoyl-CoA Oxidase) (FITC)

Gene Names
ACOX2; BCOX; BRCOX; CBAS6; THCCox; BRCACOX
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACOX2; Monoclonal Antibody; ACOX2 (Acyl-Coenzyme A Oxidase 2; Branched Chain; BCOX; BRCACOX; BRCOX; THCCox; Peroxisomal Branched Chain Acyl-CoA Oxidase; THCA-CoA Oxidase; Trihydroxycoprostanoyl-CoA Oxidase) (FITC); anti-ACOX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D1
Specificity
Recognizes human ACOX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
681
Applicable Applications for anti-ACOX2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa582-682 from ACOX2 (NP_003491) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of ACOX2 expression in transfected 293T cell line by ACOX2 monoclonal antibody Lane 1: ACOX2 transfected lysate (77kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACOX2 expression in transfected 293T cell line by ACOX2 monoclonal antibody Lane 1: ACOX2 transfected lysate (77kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ACOX2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACOX2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-ACOX2 antibody
ACOX2 belongs to the acyl-CoA oxidases family. It is a branched-chain acyl-CoA oxidase, and is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. It oxidizes the CoA esters of the bile acid intermediates di- and tri-hydroxycholestanoic acids. Mutations resulting in the deficiency of ACOX2 lead to the accumulation of branched fatty acids and bile acid intermediates.
Product Categories/Family for anti-ACOX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
peroxisomal acyl-coenzyme A oxidase 2
NCBI Official Synonym Full Names
acyl-CoA oxidase 2
NCBI Official Symbol
ACOX2
NCBI Official Synonym Symbols
BCOX; BRCOX; CBAS6; THCCox; BRCACOX
NCBI Protein Information
peroxisomal acyl-coenzyme A oxidase 2
UniProt Protein Name
Peroxisomal acyl-coenzyme A oxidase 2
UniProt Gene Name
ACOX2
UniProt Entry Name
ACOX2_HUMAN

NCBI Description

The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe cognitive disability, and death in children. [provided by RefSeq, Mar 2009]

Research Articles on ACOX2

Similar Products

Product Notes

The ACOX2 acox2 (Catalog #AAA6145752) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACOX2 (Acyl-Coenzyme An Oxidase 2, Branched Chain, BCOX, BRCACOX, BRCOX, THCCox, Peroxisomal Branched Chain Acyl-CoA Oxidase, THCA-CoA Oxidase, Trihydroxycoprostanoyl-CoA Oxidase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACOX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACOX2 acox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACOX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.