Testing Data
(Detection limit for recombinant GST tagged ACOX2 is 0.03 ng/ml as a capture antibody.)
Mouse ACOX2 Monoclonal Antibody | anti-ACOX2 antibody
ACOX2 (Acyl-Coenzyme A Oxidase 2, branched Chain, BCOX, BRCACOX, BRCOX, THCCox) (APC)
Gene Names
ACOX2; BCOX; BRCOX; CBAS6; THCCox; BRCACOX
Applications
Western Blot
Purity
Purified
Synonyms
ACOX2; Monoclonal Antibody; ACOX2 (Acyl-Coenzyme A Oxidase 2; branched Chain; BCOX; BRCACOX; BRCOX; THCCox) (APC); Acyl-Coenzyme A Oxidase 2; THCCox; anti-ACOX2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A7
Specificity
Recognizes ACOX2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
681
Applicable Applications for anti-ACOX2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ACOX2 (NP_003491, 582aa-681aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ACOX2 is 0.03 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ACOX2 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-ACOX2 antibody
The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation, and death in children. [provided by RefSeq]
Product Categories/Family for anti-ACOX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
peroxisomal acyl-coenzyme A oxidase 2
NCBI Official Synonym Full Names
acyl-CoA oxidase 2
NCBI Official Symbol
ACOX2
NCBI Official Synonym Symbols
BCOX; BRCOX; CBAS6; THCCox; BRCACOX
NCBI Protein Information
peroxisomal acyl-coenzyme A oxidase 2
UniProt Protein Name
Peroxisomal acyl-coenzyme A oxidase 2
Protein Family
UniProt Gene Name
ACOX2
UniProt Entry Name
ACOX2_HUMAN
NCBI Description
The product of this gene belongs to the acyl-CoA oxidase family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe cognitive disability, and death in children. [provided by RefSeq, Mar 2009]
Research Articles on ACOX2
Similar Products
Product Notes
The ACOX2 acox2 (Catalog #AAA6169392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACOX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACOX2 acox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACOX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
