Mouse anti-Human CASP14 Monoclonal Antibody | anti-CASP14 antibody

CASP14 (Caspase-14, CASP-14, Caspase-14 Subunit p19, Caspase-14 Subunit p10)

Cat. Num. AAA6013237

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CASP14; Monoclonal Antibody; CASP14 (Caspase-14; CASP-14; Caspase-14 Subunit p19; Caspase-14 Subunit p10); Anti -CASP14 (Caspase-14; anti-CASP14 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C9
• Specificity: Recognizes human CASP14.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ*

• Applicable Applications for anti-CASP14 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 15ug/ml
• Immunogen: Partial recombinant corresponding to aa133-243 from CASP14 (NP_036246) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(CASP14 monoclonal antibody. Western Blot analysis of CASP14 expression in MCF-7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CASP14 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-CASP14 antibody

CASP14 is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo.

Product Categories/Family for anti-CASP14 antibody

Antibodies; Abs to Apoptosis; Caspase

NCBI and Uniprot Product Information

• NCBI GI #: 6912286
• NCBI GeneID: 23581
• NCBI Accession #: NP_036246.1
• NCBI GenBank Nucleotide #: NM_012114.2
• UniProt Accession #: P31944; O95823; Q3SYC9
• Molecular Weight: 27,680 Da
• NCBI Official Full Name: caspase-14
• NCBI Official Synonym Full Names: caspase 14, apoptosis-related cysteine peptidase
• NCBI Official Symbol: CASP14
• NCBI Protein Information: caspase-14; CASP-14; apoptosis-related cysteine protease; caspase 14, apoptosis-related cysteine protease
• UniProt Protein Name: Caspase-14
• Protein Family: Caspase
• UniProt Gene Name: CASP14
• UniProt Synonym Gene Names: CASP-14
• UniProt Entry Name: CASPE_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier. [provided by RefSeq, Jul 2008]

Uniprot Description

CASP14: Believed to be a non-apoptotic caspase which is involved in epidermal differentiation. Seems to play a role in keratinocyte differentiation and cornification. Probably regulates maturation of the epidermis by proteolytically processing filaggrin. Complex of unprocessed caspase-14 and processed 19 kDa (p19) and 10 kDa (p10) subunits. In undifferentiated keratinocytes under postconfluency growth conditions (in vitro). Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum). Expressed in keratinocytes of hair shaft and sebaceous glands. In psoriatic skin only expressed at very low levels. Belongs to the peptidase C14A family.

Protein type: Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: cytoplasm; keratin filament; nucleus

Molecular Function: cysteine-type endopeptidase activity

Biological Process: epidermis development; DNA damage response, signal transduction resulting in induction of apoptosis; keratinization; proteolysis