Western Blot (WB)
(Western Blot analysis of MEIS3 expression in transfected 293T cell line by MEIS3 polyclonal antibody. Lane 1: MEIS3 transfected lysate (46.31kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human MEIS3 Polyclonal Antibody
MEIS3 (MRG2, Homeobox Protein Meis3, Meis1-related Protein 2, DKFZp547H236)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MEIS3; Polyclonal Antibody; MEIS3 (MRG2; Homeobox Protein Meis3; Meis1-related Protein 2; DKFZp547H236); Anti -MEIS3 (MRG2; anti-MEIS3 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MEIS3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
Applicable Applications for anti-MEIS3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MEIS3, aa1-421 (NP_064545.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of MEIS3 expression in transfected 293T cell line by MEIS3 polyclonal antibody. Lane 1: MEIS3 transfected lysate (46.31kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MEIS3 expression in transfected 293T cell line by MEIS3 polyclonal antibody. Lane 1: MEIS3 transfected lysate (46.31kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MEIS3 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-MEIS3 antibody
NCBI and Uniprot Product Information
Uniprot Description
MEIS3: Belongs to the TALE/MEIS homeobox family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: DNA-binding
Cellular Component: nucleus
Molecular Function: DNA binding; sequence-specific DNA binding; chromatin binding
Biological Process: transcription from RNA polymerase II promoter; positive regulation of protein kinase B signaling cascade; regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter
Similar Products
Product Notes
The MEIS3 (Catalog #AAA6008366) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MEIS3 (MRG2, Homeobox Protein Meis3, Meis1-related Protein 2, DKFZp547H236) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MEIS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MEIS3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARRYDELPH YPGIVDGPAA LASFPETVPA VPGPYGPHRP PQPLPPGLDS DGLKREKDEI YGHPLFPLLA LVFEKCELAT CSPRDGAGAG LGTPPGGDVC SSDSFNEDIA AFAKQVRSER PLFSSNPELD NLMIQAIQVL RFHLLELEKV HDLCDNFCHR YITCLKGKMP IDLVIEDRDG GCREDFEDYP ASCPSLPDQN NMWIRDHEDS GSVHLGTPGP SSGGLASQSG DNSSDQGDGL DTSVASPSSG GEDEDLDQER RRNKKRGIFP KVATNIMRAW LFQHLSRRSE APVLPDVCLG LGSPSPGPRW ARPWGSDCGR PGRQSDSCWW LQHPYPSEEQ KKQLAQDTGL TILQVNNWFI NARRRIVQPM IDQSNRTGQG AAFSPEGQPI GGYTETQPHV AVRPPGSVGM SLNLEGEWHY L. It is sometimes possible for the material contained within the vial of "MEIS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
