Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 polyclonal antibody. Lane 1: HOXC4 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HOXC4 Polyclonal Antibody | anti-HOXC4 antibody

HOXC4 (HOX3E, Homeobox Protein Hox-C4, Homeobox Protein CP19, Homeobox Protein Hox-3E)

Gene Names
HOXC4; HOX3; cp19; HOX3E
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HOXC4; Polyclonal Antibody; HOXC4 (HOX3E; Homeobox Protein Hox-C4; Homeobox Protein CP19; Homeobox Protein Hox-3E); Anti -HOXC4 (HOX3E; anti-HOXC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HOXC4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL
Applicable Applications for anti-HOXC4 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HOXC4, aa1-264 (NP_055435.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 polyclonal antibody. Lane 1: HOXC4 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 polyclonal antibody. Lane 1: HOXC4 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HOXC4 antibody
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons.
Product Categories/Family for anti-HOXC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,811 Da
NCBI Official Full Name
homeobox protein Hox-C4
NCBI Official Synonym Full Names
homeobox C4
NCBI Official Symbol
HOXC4
NCBI Official Synonym Symbols
HOX3; cp19; HOX3E
NCBI Protein Information
homeobox protein Hox-C4; homeo box 3E; homeo box C4; homeobox protein CP19; homeobox protein Hox-3E
UniProt Protein Name
Homeobox protein Hox-C4
Protein Family
UniProt Gene Name
HOXC4
UniProt Synonym Gene Names
HOX3E
UniProt Entry Name
HXC4_HUMAN

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXC4: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family. Deformed subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; embryonic organ morphogenesis; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cartilage development

Research Articles on HOXC4

Similar Products

Product Notes

The HOXC4 hoxc4 (Catalog #AAA6009134) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXC4 (HOX3E, Homeobox Protein Hox-C4, Homeobox Protein CP19, Homeobox Protein Hox-3E) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HOXC4 hoxc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIMSSYLMDS NYIDPKFPPC EEYSQNSYIP EHSPEYYGRT RESGFQHHHQ ELYPPPPPRP SYPERQYSCT SLQGPGNSRG HGPAQAGHHH PEKSQSLCEP APLSGASASP SPAPPACSQP APDHPSSAAS KQPIVYPWMK KIHVSTVNPN YNGGEPKRSR TAYTRQQVLE LEKEFHYNRY LTRRRRIEIA HSLCLSERQI KIWFQNRRMK WKKDHRLPNT KVRSAPPAGA APSTLSAATP GTSEDHSQSA TPPEQQRAED ITRL. It is sometimes possible for the material contained within the vial of "HOXC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.