Mouse anti-Human PDZD6 Polyclonal Antibody | anti-INTU antibody

PDZD6 (INTU, KIAA1284, PDZD6, PDZK6, Protein Inturned, Inturned Planar Cell Polarity Effector Homolog, PDZ Domain-containing Protein 6)

Cat. Num. AAA6008288

• Gene Names: INTU; INT; PDZD6; PDZK6
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PDZD6; Polyclonal Antibody; PDZD6 (INTU; KIAA1284; PDZK6; Protein Inturned; Inturned Planar Cell Polarity Effector Homolog; PDZ Domain-containing Protein 6); Anti -PDZD6 (INTU; anti-INTU antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human INTU.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEIELPSSAHTHGERN

• Applicable Applications for anti-INTU antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human INTU, aa1-408 (ENSP00000296461).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PDZD6 polyclonal antibody. Western Blot analysis of PDZD6 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of INTU expression in transfected 293T cell line by INTU polyclonal antibody. Lane 1: PDZD6 transfected lysate (44.88kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-INTU antibody

Plays a key role in ciliogenesis and embryonic development. Regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. Plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension. Has an indirect effect on hedgehog signaling.

Product Categories/Family for anti-INTU antibody

Antibodies; Abs to PDZ Domain

NCBI and Uniprot Product Information

• NCBI GI #: 44888833
• NCBI GeneID: 27152
• NCBI Accession #: NP_056508.2
• NCBI GenBank Nucleotide #: NM_015693.3
• UniProt Accession #: Q9ULD6; Q4W5I8; Q86V55; A1L4N5; D6RAE6; D6RBT4
• Molecular Weight: 105,648 Da
• NCBI Official Full Name: protein inturned
• NCBI Official Synonym Full Names: inturned planar cell polarity protein
• NCBI Official Symbol: INTU
• NCBI Official Synonym Symbols: INT; PDZD6; PDZK6
• NCBI Protein Information: protein inturned; homolog of inturned; PDZ domain containing 6; PDZ domain-containing protein 6; inturned planar cell polarity effector homolog
• UniProt Protein Name: Protein inturned
• UniProt Gene Name: INTU
• UniProt Synonym Gene Names: KIAA1284; PDZD6; PDZK6
• UniProt Entry Name: INTU_HUMAN

Uniprot Description

INTU: Plays a key role in ciliogenesis and embryonic development. Regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. Plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension. Has an indirect effect on hedgehog signaling. Belongs to the inturned family. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 4q28.1

Cellular Component: cell surface; cytoplasm

Biological Process: limb development; keratinocyte differentiation; nervous system development; hair follicle morphogenesis; spinal cord dorsal/ventral patterning; positive regulation of smoothened signaling pathway; cilium biogenesis; negative regulation of cell division; regulation of smoothened signaling pathway