Testing Data
(Detection limit for recombinant GST tagged MYO7A is ~0.1ng/ml as a capture antibody.)
Mouse anti-Human MYO7A Monoclonal Antibody | anti-Myo7a antibody
MYO7A (Unconventional Myosin-VIIa, USH1B)
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MYO7A; Monoclonal Antibody; MYO7A (Unconventional Myosin-VIIa; USH1B); Anti -MYO7A (Unconventional Myosin-VIIa; anti-Myo7a antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D3
Specificity
Recognizes human MYO7A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS
Applicable Applications for anti-Myo7a antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa2118-2213 from human MYO7A (NP_000251) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged MYO7A is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MYO7A is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-Myo7a antibody
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. In the retina, plays an important role in the renewal of the outer photoreceptor disks. Plays an important role in the distribution and migration of retinal pigment epithelial (RPE) melanosomes and phagosomes, and in the regulation of opsin transport in retinal photoreceptors. In the inner ear, plays an important role in differentiation, morphogenesis and organization of cochlear hair cell bundles. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity By similarity. Motor protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.
Product Categories/Family for anti-Myo7a antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
myosin-VIIa
NCBI Official Synonym Full Names
myosin VIIA
NCBI Official Symbol
Myo7a
NCBI Protein Information
myosin-VIIa; myosin VIIA (Usher syndrome 1B (autosomal recessive, severe))
Protein Family
NCBI Description
a myosin with a plus-directed motor [RGD, Feb 2006]
Research Articles on Myo7a
Similar Products
Product Notes
The Myo7a (Catalog #AAA6005307) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYO7A (Unconventional Myosin-VIIa, USH1B) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYO7A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the Myo7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KQTTEPNFPE ILLIAINKYG VSLIDPKTKD ILTTHPFTKI SNWSSGNTYF HITIGNLVRG SKLLCETSLG YKMDDLLTSY ISQMLTAMSK QRGSRS. It is sometimes possible for the material contained within the vial of "MYO7A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
