Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MYO7A is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human MYO7A Monoclonal Antibody | anti-MYO7A antibody

MYO7A (Unconventional Myosin-VIIa, USH1B) (Biotin)

Gene Names
MYO7A; DFNB2; MYU7A; NSRD2; USH1B; DFNA11; MYOVIIA
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYO7A; Monoclonal Antibody; MYO7A (Unconventional Myosin-VIIa; USH1B) (Biotin); anti-MYO7A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D3
Specificity
Recognizes human MYO7A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2215
Applicable Applications for anti-MYO7A antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2118-2213 from human MYO7A (NP_000251) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MYO7A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MYO7A is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-MYO7A antibody
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. In the retina, plays an important role in the renewal of the outer photoreceptor disks. Plays an important role in the distribution and migration of retinal pigment epithelial (RPE) melanosomes and phagosomes, and in the regulation of opsin transport in retinal photoreceptors. In the inner ear, plays an important role in differentiation, morphogenesis and organization of cochlear hair cell bundles. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity By similarity. Motor protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.
Product Categories/Family for anti-MYO7A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
unconventional myosin-VIIa isoform 1
NCBI Official Synonym Full Names
myosin VIIA
NCBI Official Symbol
MYO7A
NCBI Official Synonym Symbols
DFNB2; MYU7A; NSRD2; USH1B; DFNA11; MYOVIIA
NCBI Protein Information
unconventional myosin-VIIa
UniProt Protein Name
Unconventional myosin-VIIa
Protein Family
UniProt Gene Name
MYO7A
UniProt Synonym Gene Names
USH1B
UniProt Entry Name
MYO7A_HUMAN

NCBI Description

This gene is a member of the myosin gene family. Myosins are mechanochemical proteins characterized by the presence of a motor domain, an actin-binding domain, a neck domain that interacts with other proteins, and a tail domain that serves as an anchor. This gene encodes an unconventional myosin with a very short tail. Defects in this gene are associated with the mouse shaker-1 phenotype and the human Usher syndrome 1B which are characterized by deafness, reduced vestibular function, and (in human) retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

MYO7A: an actin-based motor molecule with ATPase activity and a calcium sensitive calmodulin binding subunit. May play a role in trafficking of ribbon- synaptic vesicle complexes and renewal of outer photoreceptor disks. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity. Seven alternatively spliced isoforms have been described.

Protein type: Motor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: stereocilium; photoreceptor inner segment; photoreceptor outer segment; lysosomal membrane; cytoplasm; apical plasma membrane; melanosome; synapse; cell cortex; cytosol; photoreceptor connecting cilium

Molecular Function: actin filament binding; microfilament motor activity; calmodulin binding; protein domain specific binding; protein binding; protein homodimerization activity; spectrin binding; ADP binding; actin-dependent ATPase activity; ATP binding

Biological Process: phagolysosome formation; intracellular protein transport; eye photoreceptor cell development; sensory perception of sound; pigment granule transport; visual perception; actin filament-based movement; lysosome organization and biogenesis; metabolic process; sensory perception of light stimulus; auditory receptor cell stereocilium organization and biogenesis; equilibrioception; post-embryonic organ morphogenesis

Disease: Deafness, Autosomal Dominant 11; Deafness, Autosomal Recessive 2; Usher Syndrome, Type I

Research Articles on MYO7A

Similar Products

Product Notes

The MYO7A myo7a (Catalog #AAA6143064) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYO7A (Unconventional Myosin-VIIa, USH1B) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYO7A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYO7A myo7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYO7A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.