Western Blot (WB)
(WB Suggested Anti-CREBZF Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: CCRF-CEM cell lysateCREBZF is strongly supported by BioGPS gene expression data to be expressed in Human CCRT-CEM cells)
Rabbit CREBZF Polyclonal Antibody | anti-CREBZF antibody
CREBZF antibody - C-terminal region
Gene Names
CREBZF; ZF; SMILE
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CREBZF; Polyclonal Antibody; CREBZF antibody - C-terminal region; anti-CREBZF antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCS
Sequence Length
272
Applicable Applications for anti-CREBZF antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CREBZF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CREBZF Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: CCRF-CEM cell lysateCREBZF is strongly supported by BioGPS gene expression data to be expressed in Human CCRT-CEM cells)
Western Blot (WB)
(WB Suggested Anti-CREBZF Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: CCRF-CEM cell lysateCREBZF is strongly supported by BioGPS gene expression data to be expressed in Human CCRT-CEM cells)
Related Product Information for anti-CREBZF antibody
This is a rabbit polyclonal antibody against CREBZF. It was validated on Western Blot
Target Description: CREBZF strongly activates transcription when bound to HCFC1. CREBZF suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. It is able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Target Description: CREBZF strongly activates transcription when bound to HCFC1. CREBZF suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. It is able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Product Categories/Family for anti-CREBZF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
HCF-binding transcription factor Zhangfei
NCBI Official Synonym Full Names
CREB/ATF bZIP transcription factor
NCBI Official Symbol
CREBZF
NCBI Official Synonym Symbols
ZF; SMILE
NCBI Protein Information
CREB/ATF bZIP transcription factor
UniProt Protein Name
CREB/ATF bZIP transcription factor
Protein Family
UniProt Gene Name
CREBZF
UniProt Synonym Gene Names
ZF; HCF-binding transcription factor Zhangfei
UniProt Entry Name
ZHANG_HUMAN
Uniprot Description
CREBZF: Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1- dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells. Belongs to the bZIP family. ATF subfamily.
Protein type: Nuclear receptor co-regulator; Transcription factor
Chromosomal Location of Human Ortholog: 11q14
Cellular Component: nucleus
Molecular Function: identical protein binding; protein binding; DNA binding; sequence-specific DNA binding; transcription factor activity
Biological Process: transcription, DNA-dependent; regulation of transcription factor activity; negative regulation of gene expression, epigenetic; response to virus; negative regulation of transcription, DNA-dependent
Research Articles on CREBZF
Similar Products
Product Notes
The CREBZF crebzf (Catalog #AAA3202881) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREBZF antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CREBZF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CREBZF crebzf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSLFRDSPAG DHDYALPVGK QKQDLLEEDD SAGGVCLHVD KDKVSVEFCS. It is sometimes possible for the material contained within the vial of "CREBZF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
