Mouse anti-Human ACAA2 Monoclonal Antibody | anti-acaa2 antibody

ACAA2 (Acetyl Coenzyme A Acyltransferase 2, Acetyl CoA Acyltransferase 2, 3-ketoacyl CoA Thiolase Mitochondrial, Beta Ketothiolase, DSAEC, Mitochondrial 3-oxoacyl Coenzyme A Thiolase, Mitochondrial 3-oxoacyl-CoA Thiolase, T1)

Cat. Num. AAA6002755

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ACAA2; Monoclonal Antibody; ACAA2 (Acetyl Coenzyme A Acyltransferase 2; Acetyl CoA Acyltransferase 2; 3-ketoacyl CoA Thiolase Mitochondrial; Beta Ketothiolase; DSAEC; Mitochondrial 3-oxoacyl Coenzyme A Thiolase; Mitochondrial 3-oxoacyl-CoA Thiolase; T1); Anti -ACAA2 (Acetyl Coenzyme A Acyltransferase 2; anti-acaa2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C4
• Specificity: Recognizes human ACAA2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV

• Applicable Applications for anti-acaa2 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 40ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa151-260 from ACAA2 (NP_006102) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(ACAA2 monoclonal antibody Western Blot analysis of ACAA2 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ACAA2 on HeLa cell. [antibody concentration 40ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ACAA2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-acaa2 antibody

The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq]

Product Categories/Family for anti-acaa2 antibody

Antibodies; Abs to Enzymes; Acyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 118403976
• NCBI GeneID: 779631
• NCBI Accession #: NP_001072185.1
• NCBI GenBank Nucleotide #: NM_001078717.1
• NCBI Official Full Name: acetyl-CoA acyltransferase 2
• NCBI Official Synonym Full Names: acetyl-CoA acyltransferase 2
• NCBI Official Symbol: acaa2
• NCBI Protein Information: acetyl-CoA acyltransferase 2; acetyl-Coenzyme A acyltransferase 2