Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in HeLa.)

Mouse ACAA2 Monoclonal Antibody | anti-ACAA2 antibody

ACAA2 (Acetyl-Coenzyme A Acyltransferase 2, DSAEC, FLJ35992, FLJ95265) (AP)

Gene Names
ACAA2; DSAEC
Applications
Western Blot
Purity
Purified
Synonyms
ACAA2; Monoclonal Antibody; ACAA2 (Acetyl-Coenzyme A Acyltransferase 2; DSAEC; FLJ35992; FLJ95265) (AP); Acetyl-Coenzyme A Acyltransferase 2; FLJ95265; anti-ACAA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F7
Specificity
Recognizes ACAA2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ACAA2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ACAA2 (NP_006102, 151aa-260aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in HeLa.)

Western Blot (WB) (ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged ACAA2 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACAA2 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in NIH/3T3.)

Western Blot (WB) (ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in NIH/3T3.)

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in PC-12.)

Western Blot (WB) (ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in PC-12.)

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in Raw 264.7.)

Western Blot (WB) (ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in Raw 264.7.)
Related Product Information for anti-ACAA2 antibody
The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq]
Product Categories/Family for anti-ACAA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.6 kDa (404aa) confirmed by MALDI-TOF
NCBI Official Full Name
3-ketoacyl-CoA thiolase, mitochondrial
NCBI Official Synonym Full Names
acetyl-CoA acyltransferase 2
NCBI Official Symbol
ACAA2
NCBI Official Synonym Symbols
DSAEC
NCBI Protein Information
3-ketoacyl-CoA thiolase, mitochondrial
UniProt Protein Name
3-ketoacyl-CoA thiolase, mitochondrial
UniProt Gene Name
ACAA2
UniProt Entry Name
THIM_HUMAN

NCBI Description

The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]

Uniprot Description

ACAA2: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. Belongs to the thiolase family.

Protein type: Lipid Metabolism - fatty acid; EC 2.3.1.16; Lipid Metabolism - fatty acid elongation in mitochondria; Transferase; Amino Acid Metabolism - valine, leucine and isoleucine degradation

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: protein binding; acetyl-CoA C-acyltransferase activity

Biological Process: fatty acid metabolic process; cholesterol biosynthetic process

Research Articles on ACAA2

Similar Products

Product Notes

The ACAA2 acaa2 (Catalog #AAA6163817) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACAA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACAA2 acaa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACAA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.