Mouse ACAA2 Monoclonal Antibody | anti-ACAA2 antibody

ACAA2 (Acetyl-Coenzyme A Acyltransferase 2, DSAEC, FLJ35992, FLJ95265) (Biotin)

Cat. Num. AAA6172637

• Gene Names: ACAA2; DSAEC
• Applications: Western Blot
• Purity: Purified
• Synonyms: ACAA2; Monoclonal Antibody; ACAA2 (Acetyl-Coenzyme A Acyltransferase 2; DSAEC; FLJ35992; FLJ95265) (Biotin); Acetyl-Coenzyme A Acyltransferase 2; FLJ95265; anti-ACAA2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F7
• Specificity: Recognizes ACAA2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ACAA2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ACAA2 (NP_006102, 151aa-260aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged ACAA2 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in Raw 264.7 (Cat # L024V1).)

Related Product Information for anti-ACAA2 antibody

The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq]

Product Categories/Family for anti-ACAA2 antibody

Antibodies; Enzymes; Acyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 167614485
• NCBI GeneID: 10449
• NCBI Accession #: NP_006102
• NCBI GenBank Nucleotide #: NM_006111.2
• UniProt Accession #: P42765; Q9BUT6
• Molecular Weight: 42.6 kDa (404aa) confirmed by MALDI-TOF
• NCBI Official Full Name: 3-ketoacyl-CoA thiolase, mitochondrial
• NCBI Official Synonym Full Names: acetyl-CoA acyltransferase 2
• NCBI Official Symbol: ACAA2
• NCBI Official Synonym Symbols: DSAEC
• NCBI Protein Information: 3-ketoacyl-CoA thiolase, mitochondrial
• UniProt Protein Name: 3-ketoacyl-CoA thiolase, mitochondrial
• UniProt Gene Name: ACAA2
• UniProt Entry Name: THIM_HUMAN

NCBI Description

The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]

Uniprot Description

ACAA2: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. Belongs to the thiolase family.

Protein type: Lipid Metabolism - fatty acid; EC 2.3.1.16; Lipid Metabolism - fatty acid elongation in mitochondria; Transferase; Amino Acid Metabolism - valine, leucine and isoleucine degradation

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: protein binding; acetyl-CoA C-acyltransferase activity

Biological Process: fatty acid metabolic process; cholesterol biosynthetic process