Testing Data
(Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody.)
Mouse GNL3 Monoclonal Antibody | anti-GNL3 antibody
GNL3 (Guanine Nucleotide Binding Protein-like 3 (Nucleolar), C77032, E2IG3, MGC800, NS) (APC)
Gene Names
GNL3; NS; E2IG3; NNP47; C77032
Applications
Western Blot
Purity
Purified
Synonyms
GNL3; Monoclonal Antibody; GNL3 (Guanine Nucleotide Binding Protein-like 3 (Nucleolar); C77032; E2IG3; MGC800; NS) (APC); Guanine Nucleotide Binding Protein-like 3 (Nucleolar); NS; anti-GNL3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B10
Specificity
Recognizes GNL3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
549
Applicable Applications for anti-GNL3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GNL3 (AAH01024.1, 328aa-427aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-GNL3 antibody
Mouse monoclonal antibody raised against a full length recombinant GNL3.
Product Categories/Family for anti-GNL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Guanine nucleotide binding protein-like 3 (nucleolar)
NCBI Official Synonym Full Names
G protein nucleolar 3
NCBI Official Symbol
GNL3
NCBI Official Synonym Symbols
NS; E2IG3; NNP47; C77032
NCBI Protein Information
guanine nucleotide-binding protein-like 3
Protein Family
NCBI Description
The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Research Articles on GNL3
Similar Products
Product Notes
The GNL3 (Catalog #AAA6167791) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GNL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNL3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
