Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LILRB2 expression in transfected 293T cell line by LILRB2 polyclonal antibody. Lane 1: LILRB2 transfected lysate (21.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LILRB2 Polyclonal Antibody | anti-LILRB2 antibody

LILRB2 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 2, LIR-2, Leukocyte Immunoglobulin-like Receptor 2, CD85 Antigen-like Family Member D, Immunoglobulin-like Transcript 4, ILT-4, Monocyte/Macrophage Immunoglobulin-like Receptor 10, MIR-10,

Gene Names
LILRB2; ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LILRB2; Polyclonal Antibody; LILRB2 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 2; LIR-2; Leukocyte Immunoglobulin-like Receptor 2; CD85 Antigen-like Family Member D; Immunoglobulin-like Transcript 4; ILT-4; Monocyte/Macrophage Immunoglobulin-like Receptor 10; MIR-10; ; Anti -LILRB2 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 2; anti-LILRB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LILRB2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
Applicable Applications for anti-LILRB2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human LILRB2, aa1-193 (AAH41708.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LILRB2 expression in transfected 293T cell line by LILRB2 polyclonal antibody. Lane 1: LILRB2 transfected lysate (21.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LILRB2 expression in transfected 293T cell line by LILRB2 polyclonal antibody. Lane 1: LILRB2 transfected lysate (21.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LILRB2 antibody
Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
Product Categories/Family for anti-LILRB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,039 Da
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily B member 2 isoform 1
NCBI Official Synonym Full Names
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
NCBI Official Symbol
LILRB2
NCBI Official Synonym Symbols
ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily B member 2; Ig-like transcript 4; CD85 antigen-like family member D; monocyte/macrophage immunoglobulin-like receptor 10
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Gene Name
LILRB2
UniProt Synonym Gene Names
ILT4; LIR2; MIR10; LIR-2; Leukocyte immunoglobulin-like receptor 2; ILT-4; MIR-10
UniProt Entry Name
LIRB2_HUMAN

NCBI Description

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

LILRB2: Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: extracellular space; cell surface; membrane; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; MHC class I protein binding; cell adhesion molecule binding; receptor activity; protein phosphatase 1 binding; inhibitory MHC class I receptor activity

Biological Process: immune response-inhibiting cell surface receptor signaling pathway; negative regulation of calcium ion transport; regulation of immune response; positive regulation of regulatory T cell differentiation; negative regulation of immune response; positive regulation of interleukin-6 production; signal transduction; positive regulation of tolerance induction; heterotypic cell-cell adhesion; cell surface receptor linked signal transduction; negative regulation of T cell proliferation; cell-cell signaling; negative regulation of antigen processing and presentation; cellular defense response; positive regulation of T cell proliferation; immune response; Fc receptor mediated inhibitory signaling pathway; positive regulation of T cell tolerance induction

Research Articles on LILRB2

Similar Products

Product Notes

The LILRB2 lilrb2 (Catalog #AAA6000494) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LILRB2 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 2, LIR-2, Leukocyte Immunoglobulin-like Receptor 2, CD85 Antigen-like Family Member D, Immunoglobulin-like Transcript 4, ILT-4, Monocyte/Macrophage Immunoglobulin-like Receptor 10, MIR-10, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LILRB2 lilrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTPALTALLC LGLSLGPRTR VQAGPFPKPT LWAEPGSVIS WGSPVTIWCQ GSLEAQEYQL DKEGSPEPLD RNNPLEPKNK ARFSIPSMTQ HHAGRYRCHY YSSAGWSEPS DPLELVMTGF YNKPTLSALP SPVVASGGNM TLRCGSQKGY HHFVLMKEGE HQLPRTLDSQ QLHSGGFQAL FPVGPVTPSH RRV. It is sometimes possible for the material contained within the vial of "LILRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.