TIMP3 recombinant protein
TIMP3 protein
Gene Names
TIMP3; SFD; K222; K222TA2; HSMRK222
Applications
ELISA, SDS-Page, Western Blot
Purity
> 90% pure
Synonyms
TIMP3; TIMP3 protein; Recombinant Human Metalloproteinase inhibitor 3 (TIMP3); partial; Protein MIG 5 protein; Tissue inhibitor of metalloproteinases 3 protein; TIMP 3 protein; Metalloproteinase inhibitor 3 protein; TIMP-3 protein; TIMP3 recombinant protein
Host
E Coli
Purity/Purification
> 90% pure
Form/Format
10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 20% glycerol
Sequence Positions
30-208
Sequence
HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Applicable Applications for TIMP3 recombinant protein
ELISA (EIA), SDS-PAGE, Western Blot (WB)
Species
Human
Protein Type
Recombinant
Preparation and Storage
Store at 4 degree C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 degree C, avoid repeat freeze/thaw cycles
Related Product Information for TIMP3 recombinant protein
TIMP3 complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Product Categories/Family for TIMP3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
46 kDa
NCBI Official Full Name
TIMP3
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 3
NCBI Official Symbol
TIMP3
NCBI Official Synonym Symbols
SFD; K222; K222TA2; HSMRK222
NCBI Protein Information
metalloproteinase inhibitor 3
UniProt Protein Name
Metalloproteinase inhibitor 3
Protein Family
UniProt Gene Name
TIMP3
UniProt Synonym Gene Names
TIMP-3
UniProt Entry Name
TIMP3_HUMAN
Similar Products
Product Notes
The TIMP3 timp3 (Catalog #AAA5316474) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-208. AAA Biotech's TIMP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the TIMP3 timp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HPQDAFCNSD IVIRAKVVGK KLVKEGPFGT LVYTIKQMKM YRGFTKMPHV QYIHTEASES LCGLKLEVNK YQYLLTGRVY DGKMYTGLCN FVERWDQLTL SQRKGLNYRY HLGCNCKIKS CYYLPCFVTS KNECLWTDML SNFGYPGYQS KHYACIRQKG GYCSWYRGWA PPDKSIINA. It is sometimes possible for the material contained within the vial of "TIMP3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
