Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Metalloproteinase inhibitor 3 (TIMP3) Recombinant Protein | TIMP3 recombinant protein

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial

Gene Names
TIMP3; SFD; K222; K222TA2; HSMRK222
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase inhibitor 3 (TIMP3); Recombinant Human Metalloproteinase inhibitor 3 (TIMP3); partial; Protein MIG-5; Tissue inhibitor of metalloproteinases 3; TIMP-3; TIMP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-208aa; Partial
Sequence
HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for TIMP3 recombinant protein
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Product Categories/Family for TIMP3 recombinant protein
References
Structure and expression in breast tumors of human TIMP-3, a new member of the metalloproteinase inhibitor family.Uria J.A., Ferrando A.A., Velasco G., Freije J.M., Lopez-Otin C.Cancer Res. 54:2091-2094(1994)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.8 kDa
NCBI Official Full Name
metalloproteinase inhibitor 3
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 3
NCBI Official Symbol
TIMP3
NCBI Official Synonym Symbols
SFD; K222; K222TA2; HSMRK222
NCBI Protein Information
metalloproteinase inhibitor 3
UniProt Protein Name
Metalloproteinase inhibitor 3
UniProt Gene Name
TIMP3
UniProt Synonym Gene Names
TIMP-3
UniProt Entry Name
TIMP3_HUMAN

NCBI Description

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. [provided by RefSeq, Jul 2008]

Uniprot Description

TIMP3: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15. Interacts with EFEMP1. Belongs to the protease inhibitor I35 (TIMP) family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 22q12.3

Cellular Component: basement membrane; cytoplasm; extracellular matrix; extracellular space; nucleus; proteinaceous extracellular matrix

Molecular Function: metal ion binding; metalloendopeptidase inhibitor activity; protease binding; protein binding

Biological Process: aging; central nervous system development; negative regulation of membrane protein ectodomain proteolysis; negative regulation of metalloenzyme activity; response to estrogen stimulus; response to folic acid; response to mechanical stimulus; response to organic substance; tissue regeneration; visual perception

Disease: Fundus Dystrophy, Pseudoinflammatory, Of Sorsby

Research Articles on TIMP3

Similar Products

Product Notes

The TIMP3 timp3 (Catalog #AAA1265488) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-208aa; Partial. The amino acid sequence is listed below: HPQDAFCNSD IVIRAKVVGK KLVKEGPFGT LVYTIKQMKM YRGFTKMPHV QYIHTEASES LCGLKLEVNK YQYLLTGRVY DGKMYTGLCN FVERWDQLTL SQRKGLNYRY HLGCNCKIKS CYYLPCFVTS KNECLWTDML SNFGYPGYQS KHYACIRQKG GYCSWYRGWA PPDKSIINA . It is sometimes possible for the material contained within the vial of "Metalloproteinase inhibitor 3 (TIMP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.