Western Blot (WB)
(TIMM44 antibody (MBS5303345) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Mouse TIMM44 Polyclonal Antibody | anti-TIMM44 antibody
TIMM44 antibody
Gene Names
TIMM44; TIM44
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TIMM44; Polyclonal Antibody; TIMM44 antibody; Polyclonal TIMM44; Anti-TIMM44; Translocase Of Inner Mitochondrial Membrane 44 Homolog; TIMM-44; TIMM 44; DKFZp686H05241; TIM44; anti-TIMM44 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TIMM44 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
452
Applicable Applications for anti-TIMM44 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TIMM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.
Cross-Reactivity
Human,Mouse
Immunogen
TIMM44 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TIMM44 antibody (MBS5303345) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TIMM44 antibody (MBS5303345) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TIMM44 antibody
Rabbit polyclonal TIMM44 antibody
Product Categories/Family for anti-TIMM44 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
51 kDa (MW of target protein)
NCBI Official Full Name
TIMM44, partial
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 44 homolog (yeast)
NCBI Official Symbol
TIMM44
NCBI Official Synonym Symbols
TIM44
NCBI Protein Information
mitochondrial import inner membrane translocase subunit TIM44
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM44
Protein Family
UniProt Gene Name
TIMM44
UniProt Synonym Gene Names
MIMT44; TIM44
UniProt Entry Name
TIM44_HUMAN
Uniprot Description
TIMM44: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source. Belongs to the Tim44 family.
Protein type: Mitochondrial
Chromosomal Location of Human Ortholog: 19p13.2
Cellular Component: mitochondrion; mitochondrial matrix; mitochondrial inner membrane
Molecular Function: protein binding; chaperone binding; P-P-bond-hydrolysis-driven protein transmembrane transporter activity; ATP binding
Biological Process: protein import into mitochondrial matrix; cellular protein metabolic process; protein targeting to mitochondrion
Research Articles on TIMM44
Similar Products
Product Notes
The TIMM44 timm44 (Catalog #AAA5303345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIMM44 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM44 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TIMM44 timm44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMM44, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
