Western Blot (WB)
(FBXO36 antibody (MBS5303212) used at 1 ug/ml to detect target protein.)
Rabbit FBXO36 Polyclonal Antibody | anti-FBXO36 antibody
FBXO36 antibody
Gene Names
FBXO36; Fbx36
Applications
Western Blot
Purity
Affinity purified
Synonyms
FBXO36; Polyclonal Antibody; FBXO36 antibody; Polyclonal FBXO36; Anti-FBXO36; F-Box Protein 36; FBXO-36; FLJ41090; FBXO 36; FLJ37592; Fbx36; anti-FBXO36 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
FBXO36 antibody was raised against the N terminal of FBXO36
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO36 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
157
Applicable Applications for anti-FBXO36 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Cross-Reactivity
Human
Immunogen
FBXO36 antibody was raised using the N terminal of FBXO36 corresponding to a region with amino acids QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(FBXO36 antibody (MBS5303212) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(FBXO36 antibody (MBS5303212) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FBXO36 antibody
Rabbit polyclonal FBXO36 antibody raised against the N terminal of FBXO36
Product Categories/Family for anti-FBXO36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
22 kDa (MW of target protein)
NCBI Official Full Name
FBXO36 protein
NCBI Official Synonym Full Names
F-box protein 36
NCBI Official Symbol
FBXO36
NCBI Official Synonym Symbols
Fbx36
NCBI Protein Information
F-box only protein 36
UniProt Protein Name
F-box only protein 36
Protein Family
UniProt Gene Name
FBXO36
UniProt Synonym Gene Names
FBX36
UniProt Entry Name
FBX36_HUMAN
NCBI Description
Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Uniprot Description
FBXO36: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex.
Chromosomal Location of Human Ortholog: 2q36.3
Research Articles on FBXO36
Similar Products
Product Notes
The FBXO36 fbxo36 (Catalog #AAA5303212) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FBXO36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FBXO36 fbxo36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
