Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FBXO33 antibody (MBS5303481) used at 1 ug/ml to detect target protein.)

Rabbit FBXO33 Polyclonal Antibody | anti-FBXO33 antibody

FBXO33 antibody

Gene Names
FBXO33; Fbx33; BMND12; c14_5247
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
FBXO33; Polyclonal Antibody; FBXO33 antibody; Polyclonal FBXO33; Anti-FBXO33; FBXO 33; Fbx33; F-Box Protein 33; c14_5247; FBXO-33; anti-FBXO33 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
FBXO33 antibody was raised against the middle region of FBXO33
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO33 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
160
Applicable Applications for anti-FBXO33 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FBXO33 antibody (MBS5303481) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (FBXO33 antibody (MBS5303481) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FBXO33 antibody
Rabbit polyclonal FBXO33 antibody raised against the middle region of FBXO33
Product Categories/Family for anti-FBXO33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
FBXO33 protein, partial
NCBI Official Synonym Full Names
F-box protein 33
NCBI Official Symbol
FBXO33
NCBI Official Synonym Symbols
Fbx33; BMND12; c14_5247
NCBI Protein Information
F-box only protein 33
UniProt Protein Name
F-box only protein 33
Protein Family
UniProt Gene Name
FBXO33
UniProt Synonym Gene Names
FBX33
UniProt Entry Name
FBX33_HUMAN

NCBI Description

This locus represents an member of the F-box gene family. The encoded protein contains an F-box motif and a domain that might form a structure similar to a leucine-rich repeat found in placental RNAse inhibitor. This locus may be associated with copy number variation of UGT2B17 (GeneID 7367), which has been associated with susceptibility to osteoporosis.[provided by RefSeq, Sep 2010]

Uniprot Description

FBXO33: Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Recognizes YBX1.

Chromosomal Location of Human Ortholog: 14q21.1

Molecular Function: protein binding

Biological Process: protein ubiquitination

Disease: Bone Mineral Density Quantitative Trait Locus 12

Research Articles on FBXO33

Similar Products

Product Notes

The FBXO33 fbxo33 (Catalog #AAA5303481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXO33 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FBXO33 fbxo33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.