Western Blot (WB)
(GOLGB1 antibody (MBS5302119) used at 1 ug/ml to detect target protein.)
Rabbit GOLGB1 Polyclonal Antibody | anti-GOLGB1 antibody
GOLGB1 antibody
Gene Names
GOLGB1; GCP; GCP372; GOLIM1
Applications
Western Blot
Purity
Affinity purified
Synonyms
GOLGB1; Polyclonal Antibody; GOLGB1 antibody; Polyclonal GOLGB1; Anti-GOLGB1; GIANTIN; Golgin B1 Golgi Integral Membrane Protein; GCP372; GCP; GOLIM1; anti-GOLGB1 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
GOLGB1 antibody was raised against the N terminal of GOLGB1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GOLGB1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
3184
Applicable Applications for anti-GOLGB1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
Cross-Reactivity
Human
Immunogen
GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(GOLGB1 antibody (MBS5302119) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(GOLGB1 antibody (MBS5302119) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GOLGB1 antibody
Rabbit polyclonal GOLGB1 antibody raised against the N terminal of GOLGB1
Product Categories/Family for anti-GOLGB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
376 kDa (MW of target protein)
NCBI Official Full Name
golgin subfamily B member 1 isoform 4
NCBI Official Synonym Full Names
golgin B1
NCBI Official Symbol
GOLGB1
NCBI Official Synonym Symbols
GCP; GCP372; GOLIM1
NCBI Protein Information
golgin subfamily B member 1
UniProt Protein Name
Golgin subfamily B member 1
Protein Family
UniProt Gene Name
GOLGB1
UniProt Synonym Gene Names
GCP372
UniProt Entry Name
GOGB1_HUMAN
Uniprot Description
GOLGB1: May participate in forming intercisternal cross-bridges of the Golgi complex.
Protein type: Vesicle; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3q13
Cellular Component: Golgi membrane; Golgi apparatus; Golgi stack; cis-Golgi network; membrane; integral to membrane; ER-Golgi intermediate compartment
Molecular Function: protein binding
Biological Process: Golgi organization and biogenesis
Research Articles on GOLGB1
Similar Products
Product Notes
The GOLGB1 golgb1 (Catalog #AAA5302119) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GOLGB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the GOLGB1 golgb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOLGB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
