Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Claudin 9 Polyclonal Antibody | anti-CLDN9 antibody

Claudin 9 antibody

Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Claudin 9; Polyclonal Antibody; Claudin 9 antibody; Polyclonal Claudin 9; Anti-Claudin 9; Claudin -9; CLDN9; anti-CLDN9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Claudin 9 antibody was raised against the C terminal of CLDN9
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN9 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
217
Applicable Applications for anti-CLDN9 antibody
Western Blot (WB)
Application Notes
WB: 2 ug/ml
Biological Significance
CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Cross-Reactivity
Human, Mouse, Rat, Dog
Immunogen
Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-CLDN9 antibody
Rabbit polyclonal Claudin 9 antibody raised against the C terminal of CLDN9
Product Categories/Family for anti-CLDN9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24 kDa (MW of target protein)
NCBI Official Full Name
claudin-9
NCBI Official Synonym Full Names
claudin 9
NCBI Official Symbol
CLDN9
NCBI Protein Information
claudin-9
UniProt Protein Name
Claudin-9
Protein Family
UniProt Gene Name
CLDN9
UniProt Entry Name
CLD9_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein is one of the entry cofactors for hepatitis C virus. Mouse studies revealed that this gene is required for the preservation of sensory cells in the hearing organ and the gene deficiency is associated with deafness. [provided by RefSeq, Jun 2010]

Uniprot Description

Claudin-9: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Belongs to the claudin family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cell adhesion

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: tight junction; integral to membrane; plasma membrane

Molecular Function: identical protein binding; structural molecule activity

Biological Process: intercellular junction assembly and maintenance; viral reproduction; calcium-independent cell-cell adhesion

Research Articles on CLDN9

Similar Products

Product Notes

The CLDN9 cldn9 (Catalog #AAA5301922) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Claudin 9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2 ug/ml. Researchers should empirically determine the suitability of the CLDN9 cldn9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Claudin 9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.