Western Blot (WB)
(Western Blot detection against Immunogen (35.13kD).)
Mouse anti-Human KREMEN1 Monoclonal Antibody | anti-KREMEN1 antibody
KREMEN1 (KREMEN, KRM1, Kremen Protein 1, Dickkopf Receptor, Kringle Domain-containing Transmembrane Protein 1, Kringle-containing Protein Marking the Eye and the Nose, FLJ31863) (HRP)
Gene Names
KREMEN1; KRM1; KREMEN
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KREMEN1; Monoclonal Antibody; KREMEN1 (KREMEN; KRM1; Kremen Protein 1; Dickkopf Receptor; Kringle Domain-containing Transmembrane Protein 1; Kringle-containing Protein Marking the Eye and the Nose; FLJ31863) (HRP); anti-KREMEN1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E7
Specificity
Recognizes human KREMEN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-KREMEN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa310-392 from human KREMEN1 (NP_114434) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.13kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.13kD).)
Testing Data
(Detection limit for recombinant GST tagged KREMEN1 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged KREMEN1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-KREMEN1 antibody
KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. This protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.
Product Categories/Family for anti-KREMEN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54 kDa
NCBI Official Full Name
kremen protein 1 isoform 2
NCBI Official Synonym Full Names
kringle containing transmembrane protein 1
NCBI Official Symbol
KREMEN1
NCBI Official Synonym Symbols
KRM1; KREMEN
NCBI Protein Information
kremen protein 1; dickkopf receptor; kringle-coding gene marking the eye and the nose; kringle domain-containing transmembrane protein 1; kringle-containing protein marking the eye and the nose
UniProt Protein Name
Kremen protein 1
Protein Family
UniProt Gene Name
KREMEN1
UniProt Synonym Gene Names
KREMEN; KRM1
UniProt Entry Name
KREM1_HUMAN
NCBI Description
This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
KREMEN1: Receptor for Dickkopf protein. Cooperates with Dickkopf to block Wnt/beta-catenin signaling. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Receptor, misc.; Membrane protein, integral
Chromosomal Location of Human Ortholog: 22q12.1
Cellular Component: membrane; integral to membrane
Molecular Function: protein binding
Biological Process: Wnt receptor signaling pathway; cell communication
Research Articles on KREMEN1
Similar Products
Product Notes
The KREMEN1 kremen1 (Catalog #AAA6153247) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KREMEN1 (KREMEN, KRM1, Kremen Protein 1, Dickkopf Receptor, Kringle Domain-containing Transmembrane Protein 1, Kringle-containing Protein Marking the Eye and the Nose, FLJ31863) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KREMEN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KREMEN1 kremen1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KREMEN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
