Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NFKBIZ blocking peptide

NFKBIZ Peptide-C-terminal region

Reactivity
Mouse
Synonyms
NFKBIZ; NFKBIZ Peptide-C-terminal region; INAP; Mail; AA408868; NFKBIZ blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
629 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NFKBIZ blocking peptide
This is a synthetic peptide designed for use in combination with anti-NFKBIZ Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: Involved in regulation of NF-kappa-B transcription factor complexes. Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. Inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. Seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50 has transcriptional activation activity and, together with NFKB1/p50 and RELA, is recruited to LCN2 promoters. Promotes transcription of LCN2 and DEFB4. Is recruited to IL-6 promoters and activates IL-6 but decreases TNF-alpha production in response to LPS. Seems to be involved in the induction of inflammatory genes activated through TLR/IL-1 receptor signaling. May promote apoptosis (By similarity). Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR).

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
69kDa
UniProt Protein Name
NF-kappa-B inhibitor zeta
Protein Family
UniProt Gene Name
Nfkbiz
UniProt Synonym Gene Names
Inap; Mail; IkB-zeta; IkappaBzeta; INAP; MAIL
UniProt Entry Name
IKBZ_MOUSE

Similar Products

Product Notes

The NFKBIZ nfkbiz (Catalog #AAA3249448) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NFKBIZ Peptide-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: VRLLMRKGAD PSTRNLENEQ PVHLVPDGPV GEQIRRILKG KSIQQRAPPY. It is sometimes possible for the material contained within the vial of "NFKBIZ, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.