IFT122 blocking peptide
IFT122 Antibody-middle region
Reactivity
Human
Synonyms
IFT122; IFT122 Antibody-middle region; CED; SPG; CED1; WDR10; WDR10p; WDR140; IFT122 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHE
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
1182 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IFT122 blocking peptide
This is a synthetic peptide designed for use in combination with anti-IFT122 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Description of Target: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Mutations in this gene cause cranioectodermal dysplasia-1. A related pseudogene is located on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms.
Description of Target: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Mutations in this gene cause cranioectodermal dysplasia-1. A related pseudogene is located on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms.
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
130kDa
UniProt Protein Name
Intraflagellar transport protein 122 homolog
Protein Family
UniProt Gene Name
IFT122
UniProt Synonym Gene Names
SPG; WDR10; WDR140
UniProt Entry Name
IF122_HUMAN
Similar Products
Product Notes
The IFT122 ift122 (Catalog #AAA3249328) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IFT122 Antibody-middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: QDLRYLELIS SIEERKKRGE TNNDLFLADV FSYQGKFHEA AKLYKRSGHE. It is sometimes possible for the material contained within the vial of "IFT122, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
