Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human IFT122 Monoclonal Antibody | anti-IFT122 antibody

IFT122 (Intraflagellar Transport Protein 122 Homolog, WD Repeat-containing Protein 10, WD Repeat-containing Protein 140, SPG, WDR10, WDR140)

Gene Names
IFT122; CED; SPG; CED1; WDR10; WDR10p; WDR140
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
IFT122; Monoclonal Antibody; IFT122 (Intraflagellar Transport Protein 122 Homolog; WD Repeat-containing Protein 10; WD Repeat-containing Protein 140; SPG; WDR10; WDR140); Anti -IFT122 (Intraflagellar Transport Protein 122 Homolog; anti-IFT122 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E11
Specificity
Recognizes human IFT122.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPG
Applicable Applications for anti-IFT122 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1194-1292 from human IFT122 (NP_443711) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Testing Data

(Detection limit for recombinant GST tagged IFT122 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IFT122 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-IFT122 antibody
Required for cilia formation during neuronal patterning. Acts as a negative regulator of Shh signaling. Required to recruit TULP3 to primary cilia.
Product Categories/Family for anti-IFT122 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141,825 Da
NCBI Official Full Name
intraflagellar transport protein 122 homolog isoform 4
NCBI Official Synonym Full Names
intraflagellar transport 122 homolog (Chlamydomonas)
NCBI Official Symbol
IFT122
NCBI Official Synonym Symbols
CED; SPG; CED1; WDR10; WDR10p; WDR140
NCBI Protein Information
intraflagellar transport protein 122 homolog; WD repeat domain 10; WD repeat-containing protein 10; WD repeat-containing protein 140
UniProt Protein Name
Intraflagellar transport protein 122 homolog
UniProt Gene Name
IFT122
UniProt Synonym Gene Names
SPG; WDR10; WDR140
UniProt Entry Name
IF122_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Mutations in this gene cause cranioectodermal dysplasia-1. A related pseudogene is located on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

IFT122: Required for cilia formation and Shh signaling during neuronal patterning. Defects in IFT122 are a cause of cranioectodermal dysplasia type 1 (CED1). CED1 is a disorder characterized by craniofacial, skeletal and ectodermal abnormalities. Clinical features include dolichocephaly (with or without sagittal suture synostosis), scaphocephaly, short stature, limb shortening, short ribs, narrow chest, brachydactyly, renal failure and hepatic fibrosis, small and abnormally shaped teeth, sparse hair, skin laxity and abnormal nails. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: membrane; cytoplasm; photoreceptor connecting cilium; cilium

Molecular Function: protein binding

Biological Process: embryonic forelimb morphogenesis; limb development; organelle organization and biogenesis; signal transduction downstream of smoothened; embryonic body morphogenesis; camera-type eye morphogenesis; negative regulation of smoothened signaling pathway; neural tube closure; embryonic heart tube development; cilium biogenesis; embryonic digit morphogenesis; negative regulation of smoothened signaling pathway in ventral spinal cord patterning; negative regulation of epithelial cell proliferation

Disease: Cranioectodermal Dysplasia 1

Research Articles on IFT122

Similar Products

Product Notes

The IFT122 ift122 (Catalog #AAA6011179) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFT122 (Intraflagellar Transport Protein 122 Homolog, WD Repeat-containing Protein 10, WD Repeat-containing Protein 140, SPG, WDR10, WDR140) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFT122 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the IFT122 ift122 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SIGDEDPFTA KLSFEQGGSE FVPVVVSRLV LRSMSRRDVL IKRWPPPLRW QYFRSLLPDA SITMCPSCFQ MFHSEDYELL VLQHGCCPYC RRCKDDPG. It is sometimes possible for the material contained within the vial of "IFT122, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.