Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ABHD17A blocking peptide

ABHD17A Peptide - middle region

Gene Names
Abhd17a; Fam108a; upf0227; Fam108a1; RGD1359682
Reactivity
Rat
Synonyms
ABHD17A; ABHD17A Peptide - middle region; ABHD17A blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAA
Sequence Length
310
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for ABHD17A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
alpha/beta hydrolase domain-containing protein 17A
NCBI Official Synonym Full Names
abhydrolase domain containing 17A
NCBI Official Symbol
Abhd17a
NCBI Official Synonym Symbols
Fam108a; upf0227; Fam108a1; RGD1359682
NCBI Protein Information
alpha/beta hydrolase domain-containing protein 17A; protein ABHD17A
UniProt Protein Name
Alpha/beta hydrolase domain-containing protein 17A
Protein Family
UniProt Gene Name
Abhd17a
UniProt Entry Name
AB17A_RAT

Uniprot Description

ABHD17A: Belongs to the AB hydrolase superfamily. FAM108 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Hydrolase; EC 3.-.-.-; Secreted

Cellular Component: membrane; extracellular region

Molecular Function: hydrolase activity

Biological Process: metabolic process

Similar Products

Product Notes

The ABHD17A abhd17a (Catalog #AAA3248432) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ABHD17A Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNAVDLGQMC SFYVGLGTRI GCNIFSYDYS GYGISSGRPS EKNLYADIDA A. It is sometimes possible for the material contained within the vial of "ABHD17A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.