Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Transcription initiation factor IIA subunit 2 (GTF2A2) Recombinant Protein | GTF2A2 recombinant protein

Recombinant Human Transcription initiation factor IIA subunit 2 (GTF2A2)

Gene Names
GTF2A2; TF2A2; TFIIA; HsT18745
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor IIA subunit 2 (GTF2A2); Recombinant Human Transcription initiation factor IIA subunit 2 (GTF2A2); Transcription initiation factor IIA subunit 2; General transcription factor IIA subunit 2; TFIIA p12 subunit; TFIIA-12; TFIIAS; Transcription initiation factor IIA gamma chain; TFIIA-gamma; GTF2A2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-109aa; Full Length
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Sequence Length
109
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for GTF2A2 recombinant protein
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Product Categories/Family for GTF2A2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.5 kDa
NCBI Official Full Name
transcription initiation factor IIA subunit 2
NCBI Official Synonym Full Names
general transcription factor IIA, 2, 12kDa
NCBI Official Symbol
GTF2A2
NCBI Official Synonym Symbols
TF2A2; TFIIA; HsT18745
NCBI Protein Information
transcription initiation factor IIA subunit 2; TFIIAS; TFIIA-12; TFIIA-gamma; TFIIA p12 subunit; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain
UniProt Protein Name
Transcription initiation factor IIA subunit 2
UniProt Gene Name
GTF2A2
UniProt Synonym Gene Names
TF2A2; TFIIA-12; TFIIAS; TFIIA-gamma
UniProt Entry Name
T2AG_HUMAN

NCBI Description

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM, Mar 2008]

Uniprot Description

GTF2A2: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. Belongs to the TFIIA subunit 2 family.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: nucleoplasm; transcription factor TFIIA complex; cell junction

Molecular Function: protein binding; protein homodimerization activity; TATA-binding protein binding; protein heterodimerization activity; transcription coactivator activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; RNA elongation from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; gene expression; positive regulation of transcription factor activity; transcriptional preinitiation complex assembly

Research Articles on GTF2A2

Similar Products

Product Notes

The GTF2A2 gtf2a2 (Catalog #AAA949302) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-109aa; Full Length. The amino acid sequence is listed below: MAYQLYRNTT LGNSLQESLD ELIQSQQITP QLALQVLLQF DKAINAALAQ RVRNRVNFRG SLNTYRFCDN VWTFVLNDVE FREVTELIKV DKVKIVACDG KNTGSNTTE. It is sometimes possible for the material contained within the vial of "Transcription initiation factor IIA subunit 2 (GTF2A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.