Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TFB1M blocking peptide

TFB1M Peptide - C-terminal region

Gene Names
TFB1M; CGI75; mtTFB; CGI-75; mtTFB1
Reactivity
Human
Synonyms
TFB1M; TFB1M Peptide - C-terminal region; TFB1M blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SISHFKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYR
Sequence Length
346
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TFB1M blocking peptide
This is a synthetic peptide designed for use in combination with anti-TFB1M Antibody, made

Target Description: The protein encoded by this gene is a dimethyltransferase that methylates the conserved stem loop of mitochondrial 12S rRNA. The encoded protein also is part of the basal mitochondrial transcription complex and is necessary for mitochondrial gene expression. The methylation and transcriptional activities of this protein are independent of one another. Variations in this gene may influence the severity of aminoglycoside-induced deafness (AID).
Product Categories/Family for TFB1M blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
dimethyladenosine transferase 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
transcription factor B1, mitochondrial
NCBI Official Symbol
TFB1M
NCBI Official Synonym Symbols
CGI75; mtTFB; CGI-75; mtTFB1
NCBI Protein Information
dimethyladenosine transferase 1, mitochondrial
UniProt Protein Name
Dimethyladenosine transferase 1, mitochondrial
UniProt Gene Name
TFB1M
UniProt Synonym Gene Names
h-mtTFB; h-mtTFB1; hTFB1M; mtTFB1
UniProt Entry Name
TFB1M_HUMAN

NCBI Description

The protein encoded by this gene is a dimethyltransferase that methylates the conserved stem loop of mitochondrial 12S rRNA. The encoded protein also is part of the basal mitochondrial transcription complex and is necessary for mitochondrial gene expression. The methylation and transcriptional activities of this protein are independent of one another. Variations in this gene may influence the severity of aminoglycoside-induced deafness (AID).[provided by RefSeq, Aug 2010]

Uniprot Description

TFB1M: S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Variations in TFB1M may influence the clinical expression of aminoglycoside-induced deafness caused by the A1555G mutation in the mitochondrial 12S rRNA. Belongs to the methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. KsgA subfamily.

Protein type: EC 2.1.1.-; Methyltransferase

Chromosomal Location of Human Ortholog: 6q25.1-q25.3

Cellular Component: mitochondrial matrix

Molecular Function: rRNA (adenine-N6,N6-)-dimethyltransferase activity; protein binding; DNA binding

Biological Process: mitochondrion organization and biogenesis; transcription, DNA-dependent; regulation of transcription, DNA-dependent; organelle organization and biogenesis; rRNA methylation

Research Articles on TFB1M

Similar Products

Product Notes

The TFB1M tfb1m (Catalog #AAA3244710) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TFB1M Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SISHFKSLCD VYRKMCDEDP QLFAYNFREE LKRRKSKNEE KEEDDAENYR. It is sometimes possible for the material contained within the vial of "TFB1M, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.