Rabbit TFB1M Polyclonal Antibody | anti-TFB1M antibody

TFB1M antibody - N-terminal region

Cat. Num. AAA3202123

• Gene Names: TFB1M; CGI75; mtTFB; CGI-75; mtTFB1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: TFB1M; Polyclonal Antibody; TFB1M antibody - N-terminal region; anti-TFB1M antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVE
• Sequence Length: 346

• Applicable Applications for anti-TFB1M antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFB1M
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TFB1M AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC)

(Rabbit Anti-TFB1M AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(WB Suggested Anti-TFB1M Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB)

(WB Suggested Anti-TFB1M antibody Titration: 1 ug/mLSample Type: Human liver)

Related Product Information for anti-TFB1M antibody

This is a rabbit polyclonal antibody against TFB1M. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase and a DNA-binding transcription factor. Transcription factor B1 (TFB1M) is a part of this transcription complex. The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase (see POLRMT, MIM 601778) and a DNA-binding transcription factor (see TFAM, MIM 600438). Transcription factor B1 (TFB1M) is a part of this transcription complex.[supplied by OMIM].

Product Categories/Family for anti-TFB1M antibody

Polyclonal; Transcription Factor; Transcription Regulation; DNA/RNA/Protein Interactions; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 156415992
• NCBI GeneID: 51106
• NCBI Accession #: NP_057104
• NCBI GenBank Nucleotide #: NM_016020
• UniProt Accession #: Q8WVM0
• Molecular Weight: 39kDa
• NCBI Official Full Name: dimethyladenosine transferase 1, mitochondrial isoform 1
• NCBI Official Synonym Full Names: transcription factor B1, mitochondrial
• NCBI Official Symbol: TFB1M
• NCBI Official Synonym Symbols: CGI75; mtTFB; CGI-75; mtTFB1
• NCBI Protein Information: dimethyladenosine transferase 1, mitochondrial
• UniProt Protein Name: Dimethyladenosine transferase 1, mitochondrial
• Protein Family: Dimethyladenosine transferase
• UniProt Gene Name: TFB1M
• UniProt Synonym Gene Names: h-mtTFB; h-mtTFB1; hTFB1M; mtTFB1
• UniProt Entry Name: TFB1M_HUMAN

NCBI Description

The protein encoded by this gene is a dimethyltransferase that methylates the conserved stem loop of mitochondrial 12S rRNA. The encoded protein also is part of the basal mitochondrial transcription complex and is necessary for mitochondrial gene expression. The methylation and transcriptional activities of this protein are independent of one another. Variations in this gene may influence the severity of aminoglycoside-induced deafness (AID).[provided by RefSeq, Aug 2010]

Uniprot Description

TFB1M: S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Variations in TFB1M may influence the clinical expression of aminoglycoside-induced deafness caused by the A1555G mutation in the mitochondrial 12S rRNA. Belongs to the methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. KsgA subfamily.

Protein type: EC 2.1.1.-; Methyltransferase

Chromosomal Location of Human Ortholog: 6q25.1-q25.3

Cellular Component: mitochondrial matrix

Molecular Function: rRNA (adenine-N6,N6-)-dimethyltransferase activity; protein binding; DNA binding

Biological Process: mitochondrion organization and biogenesis; transcription, DNA-dependent; regulation of transcription, DNA-dependent; organelle organization and biogenesis; rRNA methylation