Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CMKLR1 blocking peptide

CMKLR1 Peptide - N-terminal region

Gene Names
CMKLR1; DEZ; RVER1; ChemR23; CHEMERINR
Reactivity
Human
Synonyms
CMKLR1; CMKLR1 Peptide - N-terminal region; CMKLR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIV
Sequence Length
373
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CMKLR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CMKLR1 Antibody, made
Product Categories/Family for CMKLR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
chemokine-like receptor 1 isoform a
NCBI Official Synonym Full Names
chemerin chemokine-like receptor 1
NCBI Official Symbol
CMKLR1
NCBI Official Synonym Symbols
DEZ; RVER1; ChemR23; CHEMERINR
NCBI Protein Information
chemokine-like receptor 1
UniProt Protein Name
Chemokine-like receptor 1
UniProt Gene Name
CMKLR1
UniProt Synonym Gene Names
CHEMR23; DEZ
UniProt Entry Name
CML1_HUMAN

Uniprot Description

CMKLR1: Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 induces activation of intracellular signaling molecules, such as SKY, MAPK1/3 (ERK1/2), MAPK14/P38MAPK and PI3K leading to multifunctional effects, like, reduction of immune responses, enhancing of adipogenesis and angionesis. Resolvin E1 down-regulates cytokine production in macrophages by reducing the activation of MAPK1/3 (ERK1/2) and NF- kappa-B. Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2). Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 12q24.1

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; chemokine receptor activity; receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of interleukin-12 production; inhibition of NF-kappaB transcription factor; regulation of calcium-mediated signaling; positive regulation of fat cell differentiation; immune response; chemotaxis; skeletal development

Research Articles on CMKLR1

Similar Products

Product Notes

The CMKLR1 cmklr1 (Catalog #AAA3244557) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CMKLR1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRMEDEDYNT SISYGDEYPD YLDSIVVLED LSPLEARVTR IFLVVVYSIV. It is sometimes possible for the material contained within the vial of "CMKLR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.