Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PDE6D blocking peptide

PDE6D Peptide - N-terminal region

Gene Names
PDE6D; PDED; JBTS22
Reactivity
Human
Applications
Western Blot
Synonyms
PDE6D; PDE6D Peptide - N-terminal region; PDE6D blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ
Sequence Length
150
Applicable Applications for PDE6D blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PDE6D blocking peptide
This is a synthetic peptide designed for use in combination with anti-PDE6D Antibody, made

Target Description: PDE6D acts as a GTP specific dissociation inhibitor (GDI). It increases the affinity of ARL3 for GTP by several orders of magnitude and does so by decreasing the nucleotide dissociation rate. It stabilizes ARL3-GTP by decreasing the nucleotide dissociation.
Product Categories/Family for PDE6D blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 6D
NCBI Official Symbol
PDE6D
NCBI Official Synonym Symbols
PDED; JBTS22
NCBI Protein Information
retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
UniProt Protein Name
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
UniProt Gene Name
PDE6D
UniProt Synonym Gene Names
PDED; GMP-PDE delta
UniProt Entry Name
PDE6D_HUMAN

NCBI Description

This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014]

Uniprot Description

PDE6D: Acts as a GTP specific dissociation inhibitor (GDI). Increases the affinity of ARL3 for GTP by several orders of magnitude and does so by decreasing the nucleotide dissociation rate. Stabilizes Arl3-GTP by decreasing the nucleotide dissociation. Belongs to the PDE6D/unc-119 family.

Chromosomal Location of Human Ortholog: 2q35-q36

Cellular Component: cytoskeleton; cytoplasmic vesicle membrane; cytoplasmic vesicle; cytosol

Molecular Function: protein binding; 3',5'-cyclic-nucleotide phosphodiesterase activity; Rab GTPase binding; GTPase inhibitor activity

Biological Process: visual perception; metabolic process; organelle organization and biogenesis; negative regulation of catalytic activity; response to stimulus

Disease: Joubert Syndrome 22

Research Articles on PDE6D

Similar Products

Product Notes

The PDE6D pde6d (Catalog #AAA3244165) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PDE6D Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE6D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE6D pde6d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLRDAETGKI LWQGTEDLSV PGVEHEARVP KKILKCKAVS RELNFSSTEQ. It is sometimes possible for the material contained within the vial of "PDE6D, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.