WDR85 blocking peptide
WDR85 Peptide - N-terminal region
Gene Names
DPH7; RRT2; WDR85; C9orf112
Reactivity
Human
Applications
Western Blot
Synonyms
WDR85; WDR85 Peptide - N-terminal region; WDR85 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
CPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYSF
Sequence Length
452
Applicable Applications for WDR85 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for WDR85 blocking peptide
WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis.
Product Categories/Family for WDR85 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
diphthine methyltransferase isoform a
NCBI Official Synonym Full Names
diphthamide biosynthesis 7
NCBI Official Symbol
DPH7
NCBI Official Synonym Symbols
RRT2; WDR85; C9orf112
NCBI Protein Information
diphthine methyltransferase
UniProt Protein Name
Diphthamide biosynthesis protein 7
Protein Family
UniProt Gene Name
DPH7
UniProt Synonym Gene Names
C9orf112; WDR85
UniProt Entry Name
DPH7_HUMAN
NCBI Description
Diphthamide is a post-translationally modified histidine residue present in elongation factor 2, and is the target of diphtheria toxin. This gene encodes a protein that contains a WD-40 domain, and is thought to be involved in diphthamide biosynthesis. A similar protein in yeast functions as a methylesterase, converting methylated diphthine to diphthine, which can then undergo amidation to produce diphthamide. [provided by RefSeq, Oct 2016]
Research Articles on WDR85
Similar Products
Product Notes
The WDR85 dph7 (Catalog #AAA3242993) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The WDR85 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR85 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR85 dph7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CPLQGCRHLL ACGTYQLRRP EDRPAGPQNK GGMEVKEPQV RLGRLFLYSF. It is sometimes possible for the material contained within the vial of "WDR85, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
