Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WDR85Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human WDR85 Polyclonal Antibody | anti-DPH7 antibody

WDR85 Antibody - N-terminal region

Gene Names
DPH7; RRT2; WDR85; C9orf112
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR85; Polyclonal Antibody; WDR85 Antibody - N-terminal region; anti-DPH7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYSF
Sequence Length
452
Applicable Applications for anti-DPH7 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR85
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WDR85Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WDR85Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DPH7 antibody
This is a rabbit polyclonal antibody against WDR85. It was validated on Western Blot

Target Description: WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis.
Product Categories/Family for anti-DPH7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
diphthine methyltransferase isoform a
NCBI Official Synonym Full Names
diphthamide biosynthesis 7
NCBI Official Symbol
DPH7
NCBI Official Synonym Symbols
RRT2; WDR85; C9orf112
NCBI Protein Information
diphthine methyltransferase
UniProt Protein Name
Diphthamide biosynthesis protein 7
UniProt Gene Name
DPH7
UniProt Synonym Gene Names
C9orf112; WDR85
UniProt Entry Name
DPH7_HUMAN

NCBI Description

Diphthamide is a post-translationally modified histidine residue present in elongation factor 2, and is the target of diphtheria toxin. This gene encodes a protein that contains a WD-40 domain, and is thought to be involved in diphthamide biosynthesis. A similar protein in yeast functions as a methylesterase, converting methylated diphthine to diphthine, which can then undergo amidation to produce diphthamide. [provided by RefSeq, Oct 2016]

Research Articles on DPH7

Similar Products

Product Notes

The DPH7 dph7 (Catalog #AAA3218100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR85 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR85 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPH7 dph7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPLQGCRHLL ACGTYQLRRP EDRPAGPQNK GGMEVKEPQV RLGRLFLYSF. It is sometimes possible for the material contained within the vial of "WDR85, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.