SELPLG blocking peptide

SELPLG Peptide - N-terminal region

Cat. Num. AAA3241738

• Gene Names: SELPLG; CLA; CD162; PSGL1; PSGL-1
• Reactivity: Human
• Applications: Western Blot
• Synonyms: SELPLG; SELPLG Peptide - N-terminal region; SELPLG blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR
• Sequence Length: 412

• Applicable Applications for SELPLG blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for SELPLG blocking peptide

This is a synthetic peptide designed for use in combination with anti-SELPLG Antibody, made

Target Description: This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.

Product Categories/Family for SELPLG blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 331284236
• NCBI GeneID: 6404
• NCBI Accession #: NP_002997
• NCBI GenBank Nucleotide #: NM_003006
• UniProt Accession #: Q14242
• Molecular Weight: 39kDa
• NCBI Official Full Name: P-selectin glycoprotein ligand 1 isoform 2
• NCBI Official Synonym Full Names: selectin P ligand
• NCBI Official Symbol: SELPLG
• NCBI Official Synonym Symbols: CLA; CD162; PSGL1; PSGL-1
• NCBI Protein Information: P-selectin glycoprotein ligand 1
• UniProt Protein Name: P-selectin glycoprotein ligand 1
• Protein Family: P-selectin glycoprotein ligand
• UniProt Gene Name: SELPLG
• UniProt Synonym Gene Names: PSGL-1
• UniProt Entry Name: SELPL_HUMAN

NCBI Description

This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2011]

Uniprot Description

SELPLG: A SLe(x)-type glycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. PSGL1 is critical for the initial leukocyte capture.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: membrane; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; receptor binding

Biological Process: blood coagulation; cell adhesion; leukocyte tethering or rolling; leukocyte adhesive activation; leukocyte migration