Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SELPLG AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit SELPLG Polyclonal Antibody | anti-SELPLG antibody

SELPLG Antibody - C-terminal region

Gene Names
SELPLG; CLA; CD162; PSGL1; PSGL-1
Reactivity
Cow, Dog, Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SELPLG; Polyclonal Antibody; SELPLG Antibody - C-terminal region; anti-SELPLG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF
Sequence Length
412
Applicable Applications for anti-SELPLG antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 83%; Guinea Pig: 92%; Human: 100%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SELPLG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SELPLG AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-SELPLG AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-SELPLG antibody
This is a rabbit polyclonal antibody against SELPLG. It was validated on Western Blot

Target Description: This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-SELPLG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
P-selectin glycoprotein ligand 1 isoform 2
NCBI Official Synonym Full Names
selectin P ligand
NCBI Official Symbol
SELPLG
NCBI Official Synonym Symbols
CLA; CD162; PSGL1; PSGL-1
NCBI Protein Information
P-selectin glycoprotein ligand 1
UniProt Protein Name
P-selectin glycoprotein ligand 1
UniProt Gene Name
SELPLG
UniProt Synonym Gene Names
PSGL-1
UniProt Entry Name
SELPL_HUMAN

NCBI Description

This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2011]

Uniprot Description

SELPLG: A SLe(x)-type glycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. PSGL1 is critical for the initial leukocyte capture.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: membrane; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; receptor binding

Biological Process: blood coagulation; cell adhesion; leukocyte tethering or rolling; leukocyte adhesive activation; leukocyte migration

Research Articles on SELPLG

Similar Products

Product Notes

The SELPLG selplg (Catalog #AAA3216837) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SELPLG Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SELPLG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SELPLG selplg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMVCISSLLP DGGEGPSATA NGGLSKAKSP GLTPEPREDR EGDDLTLHSF. It is sometimes possible for the material contained within the vial of "SELPLG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.