CAPN1 blocking peptide

CAPN1 Peptide - N-terminal region

Cat. Num. AAA3239935

• Gene Names: CAPN1; CANP; muCL; CANP1; SPG76; CANPL1; muCANP
• Reactivity: Human
• Applications: Western Blot
• Synonyms: CAPN1; CAPN1 Peptide - N-terminal region; CAPN1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL
• Sequence Length: 714

• Applicable Applications for CAPN1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CAPN1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-CAPN1 Antibody, made

Target Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.

Product Categories/Family for CAPN1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 12408656
• NCBI GeneID: 823
• NCBI Accession #: NP_005177
• NCBI GenBank Nucleotide #: NM_005186
• UniProt Accession #: P07384
• Molecular Weight: 82kDa
• NCBI Official Full Name: calpain-1 catalytic subunit
• NCBI Official Synonym Full Names: calpain 1
• NCBI Official Symbol: CAPN1
• NCBI Official Synonym Symbols: CANP; muCL; CANP1; SPG76; CANPL1; muCANP
• NCBI Protein Information: calpain-1 catalytic subunit
• UniProt Protein Name: Calpain-1 catalytic subunit
• Protein Family: Calpain
• UniProt Gene Name: CAPN1
• UniProt Synonym Gene Names: CANPL1; CANP 1; muCANP
• UniProt Entry Name: CAN1_HUMAN

NCBI Description

The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

CAPN1: Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Forms a heterodimer with a small (regulatory) subunit (CAPNS1). Ubiquitous. Activated by micromolar concentrations of calcium and inhibited by calpastatin. Belongs to the peptidase C2 family.

Protein type: EC 3.4.22.52; Motility/polarity/chemotaxis; Protease

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: focal adhesion; membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; receptor catabolic process; positive regulation of cell proliferation; proteolysis