Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CAPN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CAPN1 Polyclonal Antibody | anti-CAPN1 antibody

CAPN1 antibody - middle region

Gene Names
CAPN1; CANP; muCL; CANP1; SPG76; CANPL1; muCANP
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CAPN1; Polyclonal Antibody; CAPN1 antibody - middle region; anti-CAPN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
Sequence Length
714
Applicable Applications for anti-CAPN1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 79%; Goat: 79%; Horse: 93%; Human: 100%; Mouse: 80%; Pig: 86%; Rabbit: 79%; Rat: 83%; Sheep: 79%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAPN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CAPN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CAPN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Sample Type: Human HT1080CAPN1 antibody - middle region validated by WB using HT1080 cell lysate at 1ug/mL.)

Western Blot (WB) (Sample Type: Human HT1080CAPN1 antibody - middle region validated by WB using HT1080 cell lysate at 1ug/mL.)

Western Blot (WB)

(Lanes:1. 20 ug Jurkat cell lysate2. 20 ug Hut-78 cell lysate3. 20 ug K562 cell lysate4. 20 ug Raj cell lysate5. 20 ug U937 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:CAPN1Submitted by:Ewelina Swiderek, Institute of Immunology and Experimental Therapy, Wroclaw, Poland)

Western Blot (WB) (Lanes:1. 20 ug Jurkat cell lysate2. 20 ug Hut-78 cell lysate3. 20 ug K562 cell lysate4. 20 ug Raj cell lysate5. 20 ug U937 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:CAPN1Submitted by:Ewelina Swiderek, Institute of Immunology and Experimental Therapy, Wroclaw, Poland)

Western Blot (WB)

(Primary dilution: 1ug/mL Secondary dilution: 1:2000Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells)

Western Blot (WB) (Primary dilution: 1ug/mL Secondary dilution: 1:2000Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells)
Related Product Information for anti-CAPN1 antibody
This is a rabbit polyclonal antibody against CAPN1. It was validated on Western Blot

Target Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-CAPN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
823
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
calpain-1 catalytic subunit
NCBI Official Synonym Full Names
calpain 1
NCBI Official Symbol
CAPN1
NCBI Official Synonym Symbols
CANP; muCL; CANP1; SPG76; CANPL1; muCANP
NCBI Protein Information
calpain-1 catalytic subunit
UniProt Protein Name
Calpain-1 catalytic subunit
Protein Family
UniProt Gene Name
CAPN1
UniProt Synonym Gene Names
CANPL1; CANP 1; muCANP
UniProt Entry Name
CAN1_HUMAN

NCBI Description

The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

CAPN1: Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Forms a heterodimer with a small (regulatory) subunit (CAPNS1). Ubiquitous. Activated by micromolar concentrations of calcium and inhibited by calpastatin. Belongs to the peptidase C2 family.

Protein type: EC 3.4.22.52; Motility/polarity/chemotaxis; Protease

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: focal adhesion; membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; receptor catabolic process; positive regulation of cell proliferation; proteolysis

Research Articles on CAPN1

Similar Products

Product Notes

The CAPN1 capn1 (Catalog #AAA3215016) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN1 antibody - middle region reacts with Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CAPN1 capn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVEWTGAWSD SSSEWNNVDP YERDQLRVKM EDGEFWMSFR DFMREFTRLE. It is sometimes possible for the material contained within the vial of "CAPN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.