Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LPA blocking peptide

LPA Peptide - N-terminal region

Gene Names
LPA; LP; AK38; APOA
Reactivity
Human
Applications
Western Blot
Synonyms
LPA; LPA Peptide - N-terminal region; LPA blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS
Sequence Length
1169
Applicable Applications for LPA blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LPA blocking peptide
This is a synthetic peptide designed for use in combination with anti-LPA Antibody, made

Target Description: LPA is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the protein contains 2-43 copies of kringle-type domains.
Product Categories/Family for LPA blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
lipoprotein, Lp(a)
NCBI Official Synonym Full Names
lipoprotein(a)
NCBI Official Symbol
LPA
NCBI Official Synonym Symbols
LP; AK38; APOA
NCBI Protein Information
apolipoprotein(a)
UniProt Protein Name
Apolipoprotein(a)
UniProt Gene Name
LPA
UniProt Synonym Gene Names
Apo(a); Lp(a)
UniProt Entry Name
APOA_HUMAN

NCBI Description

The protein encoded by this gene is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The encoded protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the encoded protein contains 2-43 copies of kringle-type domains. The allele represented here contains 15 copies of the kringle-type repeats and corresponds to that found in the reference genome sequence. [provided by RefSeq, Dec 2009]

Uniprot Description

LPA: Apo(a) is the main constituent of lipoprotein(a) (Lp(a)). It has serine proteinase activity and is able of autoproteolysis. Inhibits tissue-type plasminogen activator 1. Lp(a) may be a ligand for megalin/Gp 330. Belongs to the peptidase S1 family. Plasminogen subfamily.

Protein type: Inhibitor; EC 3.4.21.-; Protease

Chromosomal Location of Human Ortholog: 6q26

Cellular Component: extracellular region

Molecular Function: heparin binding; protein binding; fibronectin binding; serine-type endopeptidase activity; endopeptidase inhibitor activity; apolipoprotein binding

Biological Process: receptor-mediated endocytosis; blood circulation; lipoprotein metabolic process; lipid metabolic process; lipid transport; proteolysis

Research Articles on LPA

Similar Products

Product Notes

The LPA lpa (Catalog #AAA3239664) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LPA Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPA lpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPDPSTEASS EEAPTEQSPG VQDCYHGDGQ SYRGSFSTTV TGRTCQSWSS. It is sometimes possible for the material contained within the vial of "LPA, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.