Mouse anti-Human CALCA Monoclonal Antibody | anti-CALCA antibody

CALCA (Calcitonin, CALC1) (AP)

Cat. Num. AAA6130326

• Gene Names: CALCA; CT; KC; PCT; CGRP; CALC1; CGRP1; CGRP-I; CGRP-alpha
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CALCA; Monoclonal Antibody; CALCA (Calcitonin; CALC1) (AP); anti-CALCA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B10
• Specificity: Recognizes human CALCA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 141

• Applicable Applications for anti-CALCA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa52-141 from human CALCA (NP_001732) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(Western Blot analysis of CALCA expression in transfected 293T cell line by CALCA monoclonal antibody. Lane 1: CALCA transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CALCA is ~1ng/ml as a capture antibody.)

Related Product Information for anti-CALCA antibody

Calcitonin is a 32aa peptide which can be demonstrated in C cells of the normal and hyperplastic thyroid. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.

Product Categories/Family for anti-CALCA antibody

Antibodies; Calcitonin

NCBI and Uniprot Product Information

• NCBI GI #: 4502545
• NCBI GeneID: 796
• NCBI Accession #: NP_001732
• NCBI GenBank Nucleotide #: NM_001741
• UniProt Accession #: P01258; P06881
• NCBI Official Full Name: calcitonin isoform CT preproprotein
• NCBI Official Synonym Full Names: calcitonin related polypeptide alpha
• NCBI Official Symbol: CALCA
• NCBI Official Synonym Symbols: CT; KC; PCT; CGRP; CALC1; CGRP1; CGRP-I; CGRP-alpha
• NCBI Protein Information: calcitonin; calcitonin gene-related peptide 1
• UniProt Protein Name: Calcitonin
• Protein Family: Calcitonin
• UniProt Gene Name: CALCA
• UniProt Synonym Gene Names: CALC1; CCP
• UniProt Entry Name: CALC_HUMAN

NCBI Description

This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2014]

Uniprot Description

CALCA: Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. Belongs to the calcitonin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: extracellular space; cell soma; cytoplasm; extracellular region; terminal button; nucleus

Molecular Function: identical protein binding; protein binding; calcitonin receptor binding; hormone activity; protein complex binding; receptor binding

Biological Process: negative regulation of osteoclast differentiation; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of interleukin-1 alpha production; vasodilation of artery during baroreceptor response to increased systemic arterial blood pressure; response to pain; positive regulation of vasodilation; protein amino acid phosphorylation; G-protein signaling, adenylate cyclase activating pathway; positive regulation of interleukin-8 production; monocyte chemotaxis; elevation of cytosolic calcium ion concentration; leukocyte adhesion; cell-cell signaling; vasculature development; neuropeptide signaling pathway; negative regulation of smooth muscle contraction; receptor internalization; regulation of blood pressure; positive regulation of cAMP biosynthetic process; negative regulation of ossification; feeding behavior; negative regulation of blood pressure; positive regulation of adenylate cyclase activity; positive regulation of macrophage differentiation; negative regulation of bone resorption; detection of temperature stimulus involved in sensory perception of pain; inflammatory response; negative regulation of neurological process; aging; cytosolic calcium ion homeostasis; regulation of heart rate; adenylate cyclase activation; positive regulation of ossification; regulation of systemic arterial blood pressure by neurological process; G-protein coupled receptor internalization; response to heat; endothelial cell proliferation; regulation of inflammatory response; activation of protein kinase activity; endothelial cell migration; negative regulation of transcription, DNA-dependent; embryo implantation