TAAR5 blocking peptide

TAAR5 Peptide - C-terminal region

Cat. Num. AAA3239362

• Gene Names: TAAR5; PNR
• Reactivity: Human
• Applications: Immunofluorescence, Western Blot
• Synonyms: TAAR5; TAAR5 Peptide - C-terminal region; TAAR5 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP
• Sequence Length: 337

• Applicable Applications for TAAR5 blocking peptide: Immunofluorescence (IF), Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for TAAR5 blocking peptide

This is a synthetic peptide designed for use in combination with anti-TAAR5 Antibody, made

Target Description: TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.

Product Categories/Family for TAAR5 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 223633986
• NCBI GeneID: 9038
• NCBI Accession #: NP_003958
• NCBI GenBank Nucleotide #: NM_003967
• UniProt Accession #: O14804
• Molecular Weight: 38kDa
• NCBI Official Full Name: trace amine-associated receptor 5
• NCBI Official Synonym Full Names: trace amine associated receptor 5
• NCBI Official Symbol: TAAR5
• NCBI Official Synonym Symbols: PNR
• NCBI Protein Information: trace amine-associated receptor 5
• UniProt Protein Name: Trace amine-associated receptor 5
• Protein Family: Trace amine-associated receptor
• UniProt Gene Name: TAAR5
• UniProt Synonym Gene Names: PNR; TaR-5; Trace amine receptor 5; hTaar5
• UniProt Entry Name: TAAR5_HUMAN

Uniprot Description

TAAR5: Orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: integral to plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; synaptic transmission; sensory perception of chemical stimulus; signal transduction