Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GNAI3Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GNAI3 Polyclonal Antibody | anti-GNAI3 antibody

GNAI3 Antibody - middle region

Gene Names
GNAI3; 87U6; ARCND1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNAI3; Polyclonal Antibody; GNAI3 Antibody - middle region; anti-GNAI3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVL
Sequence Length
354
Applicable Applications for anti-GNAI3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNAI3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GNAI3Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNAI3Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GNAI3 antibody
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway.
Product Categories/Family for anti-GNAI3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(k) subunit alpha
NCBI Official Synonym Full Names
G protein subunit alpha i3
NCBI Official Symbol
GNAI3
NCBI Official Synonym Symbols
87U6; ARCND1
NCBI Protein Information
guanine nucleotide-binding protein G(k) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(k) subunit alpha
UniProt Gene Name
GNAI3
UniProt Entry Name
GNAI3_HUMAN

NCBI Description

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway. [provided by RefSeq, Jun 2012]

Uniprot Description

G-alpha i3: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor- regulated K(+) channels. The active GTP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. May play a role in cell division. Defects in GNAI3 are the cause of auriculocondylar syndrome 1 (ARCND1). ARCND1 is an autosomal dominant craniofacial malformation syndrome characterized by variable mandibular anomalies, including mild to severe micrognathia, temporomandibular joint ankylosis, cleft palate, and a characteristic ear malformation that consists of separation of the lobule from the external ear, giving the appearance of a question mark (question-mark ear). Other frequently described features include prominent cheeks, cupped and posteriorly rotated ears, preauricular tags, and microstomia. Belongs to the G-alpha family. G(i/o/t/z) subfamily.

Protein type: G protein, heterotrimeric alpha G((i/o/t/z)); G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: Golgi apparatus; centrosome; membrane; lysosomal membrane; cytoplasm; plasma membrane; heterotrimeric G-protein complex; midbody; lipid raft

Molecular Function: GTPase activity; protein domain specific binding; signal transducer activity; GTP binding; metal ion binding; G-protein beta/gamma-subunit binding; GTPase activating protein binding; metabotropic serotonin receptor binding

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; vesicle fusion; synaptic transmission; platelet activation; metabolic process; cell division; transport; negative regulation of adenylate cyclase activity; G-protein signaling, adenylate cyclase inhibiting pathway; blood coagulation; cell cycle

Disease: Auriculocondylar Syndrome 1

Research Articles on GNAI3

Similar Products

Product Notes

The GNAI3 gnai3 (Catalog #AAA3223050) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAI3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNAI3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAI3 gnai3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIKRLWRDGG VQACFSRSRE YQLNDSASYY LNDLDRISQS NYIPTQQDVL. It is sometimes possible for the material contained within the vial of "GNAI3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.