Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Itgb1 blocking peptide

Itgb1 Peptide - C-terminal region

Gene Names
Itgb1; CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik
Reactivity
Mouse
Applications
Immunohistochemistry, Western Blot
Synonyms
Itgb1; Itgb1 Peptide - C-terminal region; Itgb1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD
Sequence Length
798
Applicable Applications for Itgb1 blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Itgb1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Itgb1 Antibody, made

Target Description: Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.
Product Categories/Family for Itgb1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
integrin beta-1
NCBI Official Synonym Full Names
integrin beta 1 (fibronectin receptor beta)
NCBI Official Symbol
Itgb1
NCBI Official Synonym Symbols
CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik
NCBI Protein Information
integrin beta-1
UniProt Protein Name
Integrin beta-1
Protein Family
UniProt Gene Name
Itgb1
UniProt Entry Name
ITB1_MOUSE

Uniprot Description

ITGB1: an integral membrane protein that heterodimerizes with an alpha-3 chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. . Beta 1 integrins recognize the amino-acid motif RGD in a wide array of ligands. Five alternatively spliced variants with alternate carboxy termini have been described. Two alternatively spliced isoforms have been described. Isoform beta-1a is widely expressed; other isoforms are generally expressed with a more restricted distribution. Isoform beta-1b is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblastoma cells, lymphoma cells, hepatoma cells and astrocytoma cells. Isoforms beta-1c and beta-1c-2 are expressed in muscle, kidney, liver, placenta, cervical epithelium, umbilical vein endothelial cells, fibroblast cells, embryonal kidney cells, platelets and several blood cell lines. Isoform beta-c-2, rather than isoform beta-1c, is selectively expressed in primary t-cells. Isoform beta-1c is expressed in nonproliferating and differentiated prostate gland epithelial cells. Isoform beta-1d is expressed specifically in striated muscle (skeletal and cardiac muscle).

Protein type: Membrane protein, integral; Cell adhesion; Receptor, misc.; Motility/polarity/chemotaxis; Cell surface

Cellular Component: focal adhesion; cell surface; dendritic spine; integral to membrane; acrosome; intercellular junction; lipid raft; cell projection; adherens junction; hemidesmosome; membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; basement membrane; synapse; cytoplasmic vesicle; neuromuscular junction; cell junction; integrin complex; receptor complex; sarcolemma; endosome; filopodium; external side of plasma membrane

Molecular Function: protein domain specific binding; protease binding; metal ion binding; laminin binding; receptor activity; actin binding; alpha-actinin binding; peptide binding; protein kinase binding; collagen binding; integrin binding; protein binding; protein heterodimerization activity; fibronectin binding; protein complex binding; cell adhesion molecule binding; glycoprotein binding; kinase binding; receptor binding

Biological Process: positive regulation of apoptosis; axon extension; regulation of cell cycle; multicellular organismal development; cell-matrix adhesion; cell fate specification; positive regulation of endocytosis; cardiac muscle cell differentiation; negative regulation of cell proliferation; leukocyte adhesion; positive regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; germ cell migration; positive regulation of cell proliferation; tissue homeostasis; visual learning; cell adhesion; negative regulation of cell projection organization and biogenesis; neurite development; integrin-mediated signaling pathway; cardiac muscle development; cell migration; in utero embryonic development; dendrite morphogenesis; sarcomere organization; protein transport within lipid bilayer; cell-substrate adhesion; formation of radial glial scaffolds; cellular calcium ion homeostasis; heterotypic cell-cell adhesion; negative regulation of cell differentiation; negative regulation of neuron differentiation; positive regulation of peptidyl-tyrosine phosphorylation; cell migration during sprouting angiogenesis; negative regulation of Rho protein signal transduction; calcium-independent cell-matrix adhesion; stress fiber formation; positive regulation of neuron differentiation; leukocyte tethering or rolling; regulation of G-protein coupled receptor protein signaling pathway; G1/S transition of mitotic cell cycle; positive regulation of cell migration

Research Articles on Itgb1

Similar Products

Product Notes

The Itgb1 itgb1 (Catalog #AAA3239012) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Itgb1 Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Itgb1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the Itgb1 itgb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PDIIPIVAGV VAGIVLIGLA LLLIWKLLMI IHDRREFAKF EKEKMNAKWD. It is sometimes possible for the material contained within the vial of "Itgb1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.