Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MRAP blocking peptide

MRAP Peptide - N-terminal region

Gene Names
MRAP; B27; FALP; FGD2; GCCD2; C21orf61
Reactivity
Human
Applications
Western Blot
Synonyms
MRAP; MRAP Peptide - N-terminal region; MRAP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFV
Sequence Length
172
Applicable Applications for MRAP blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MRAP blocking peptide
This is a synthetic peptide designed for use in combination with anti-MRAP Antibody, made

Target Description: This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described.
Product Categories/Family for MRAP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
melanocortin-2 receptor accessory protein isoform beta
NCBI Official Synonym Full Names
melanocortin 2 receptor accessory protein
NCBI Official Symbol
MRAP
NCBI Official Synonym Symbols
B27; FALP; FGD2; GCCD2; C21orf61
NCBI Protein Information
melanocortin-2 receptor accessory protein
UniProt Protein Name
Melanocortin-2 receptor accessory protein
UniProt Gene Name
MRAP
UniProt Synonym Gene Names
C21orf61; FALP
UniProt Entry Name
MRAP_HUMAN

NCBI Description

This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009]

Uniprot Description

MRAP: Required for MC2R expression in certain cell types, suggesting that it is involved in the processing, trafficking or function of MC2R. May be involved in the intracellular trafficking pathways in adipocyte cells. Defects in MRAP are the cause of glucocorticoid deficiency type 2 (GCCD2); also known as familial glucocorticoid deficiency type 2 (FGD2). GCCD2 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; plasma membrane; integral to membrane

Molecular Function: type 5 melanocortin receptor binding; type 3 melanocortin receptor binding; protein binding; type 4 melanocortin receptor binding; adrenocorticotropin hormone receptor binding

Biological Process: positive regulation of cAMP biosynthetic process; brown fat cell differentiation

Disease: Glucocorticoid Deficiency 2

Research Articles on MRAP

Similar Products

Product Notes

The MRAP mrap (Catalog #AAA3232941) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MRAP Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRAP mrap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MANGTNASAP YYSYEYYLDY LDLIPVDEKK LKAHKHSIVI AFWVSLAAFV. It is sometimes possible for the material contained within the vial of "MRAP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.