Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Abcb10 blocking peptide

Abcb10 Peptide - N-terminal region

Gene Names
Abcb10; Abc-me; Abcb12
Reactivity
Mouse
Applications
Western Blot
Synonyms
Abcb10; Abcb10 Peptide - N-terminal region; Abcb10 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD
Sequence Length
715
Applicable Applications for Abcb10 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Abcb10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Abcb10 Antibody, made

Target Description: Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Product Categories/Family for Abcb10 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
ATP-binding cassette sub-family B member 10, mitochondrial
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family B (MDR/TAP), member 10
NCBI Official Symbol
Abcb10
NCBI Official Synonym Symbols
Abc-me; Abcb12
NCBI Protein Information
ATP-binding cassette sub-family B member 10, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 10, mitochondrial
Protein Family
UniProt Gene Name
Abcb10
UniProt Synonym Gene Names
ABC-me protein; ABC transporter 10 protein
UniProt Entry Name
ABCBA_MOUSE

NCBI Description

This gene encodes a member of the ATP-binding cassette superfamily of transporters. ATP-binding cassette proteins transport various molecules across extra- and intra-cellular membranes. The encoded protein is localized to the mitochondrial inner membrane where it interacts with and stabilizes mitoferrin-1, and is important for heme biosynthesis. Additional evidence suggests the encoded protein is involved in oxidative stress protection and erythropoisesis. [provided by RefSeq, May 2013]

Research Articles on Abcb10

Similar Products

Product Notes

The Abcb10 abcb10 (Catalog #AAA3231954) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Abcb10 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Abcb10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Abcb10 abcb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NGIRVYLMQS SGQSIVNRLR TSLFSSILRQ EVAFFDKTRT GELINRLSSD. It is sometimes possible for the material contained within the vial of "Abcb10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.