Mbnl2 blocking peptide
Mbnl2 Peptide - middle region
Reactivity
RAT, Human
Applications
Western Blot
Synonyms
Mbnl2; Mbnl2 Peptide - middle region; Mbnl2 blocking peptide
Reactivity
RAT, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ
Sequence Length
378
Applicable Applications for Mbnl2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Mbnl2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Mbnl2 Antibody, made
Target Description: Mbnl2 mediates pre-mRNA alternative splicing regulation. It acts either as activator or repressor of splicing on specific pre-mRNA targets. It inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. It antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3'UTR of ITGA3. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. It seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. It may play a role in myotonic dystrophy pathophysiology (DM).
Target Description: Mbnl2 mediates pre-mRNA alternative splicing regulation. It acts either as activator or repressor of splicing on specific pre-mRNA targets. It inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. It antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3'UTR of ITGA3. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. It seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. It may play a role in myotonic dystrophy pathophysiology (DM).
Product Categories/Family for Mbnl2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
muscleblind-like protein 2
NCBI Official Synonym Full Names
muscleblind-like splicing regulator 2
NCBI Official Symbol
Mbnl2
NCBI Protein Information
muscleblind-like protein 2
UniProt Protein Name
Muscleblind-like protein 2
Protein Family
UniProt Gene Name
Mbnl2
Uniprot Description
Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3'UTR of ITGA3. Binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. Seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. May play a role in myotonic dystrophy pathophysiology (DM) ().
Research Articles on Mbnl2
Similar Products
Product Notes
The Mbnl2 mbnl2 (Catalog #AAA3230527) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Mbnl2 Peptide - middle region reacts with RAT, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Mbnl2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Mbnl2 mbnl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IACFDSLKGR CSRENCKYLH PPTHLKTQLE INGRNNLIQQ KTAAAMLAQQ. It is sometimes possible for the material contained within the vial of "Mbnl2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
