<
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that MBNL2 is expressed in HeLa)
Rabbit MBNL2 Polyclonal Antibody | anti-MBNL2 antibody
MBNL2 antibody - middle region
Gene Names
MBNL2; MBLL; MBLL39; PRO2032
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MBNL2; Polyclonal Antibody; MBNL2 antibody - middle region; anti-MBNL2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA
Sequence Length
255
Applicable Applications for anti-MBNL2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MBNL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that MBNL2 is expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that MBNL2 is expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MBNL2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-MBNL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-MBNL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-MBNL2 antibody
This is a rabbit polyclonal antibody against MBNL2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MBNL2 is a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein.MBNL2 is a RNA-binding protein that binds to 5'ACACCC-3' core sequence. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. MBNL2 seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm. It may play a role in myotonic dystrophy pathophysiology (DM).
Target Description: MBNL2 is a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein.MBNL2 is a RNA-binding protein that binds to 5'ACACCC-3' core sequence. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. MBNL2 seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm. It may play a role in myotonic dystrophy pathophysiology (DM).
Product Categories/Family for anti-MBNL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28kDa
NCBI Official Synonym Full Names
muscleblind like splicing regulator 2
NCBI Official Symbol
MBNL2
NCBI Official Synonym Symbols
MBLL; MBLL39; PRO2032
NCBI Protein Information
muscleblind-like protein 2
Protein Family
NCBI Description
This gene is a member of the muscleblind protein family which was initially described in Drosophila melanogaster. This gene encodes a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq, Mar 2012]
Research Articles on MBNL2
Similar Products
Product Notes
The MBNL2 (Catalog #AAA3210352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBNL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MBNL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MBNL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENGRVIACFD SLKGRCSREN CKYLHPPTHL KTQLEINGRN NLIQQKTAAA. It is sometimes possible for the material contained within the vial of "MBNL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
