Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human DCXR Monoclonal Antibody | anti-DCXR antibody

DCXR (L-xylulose Reductase, XR, Carbonyl Reductase II, Dicarbonyl/L-xylulose Reductase, Kidney Dicarbonyl Reductase, kiDCR, Sperm Surface Protein P34H) (Biotin)

Gene Names
DCXR; XR; DCR; HCR2; P34H; HCRII; KIDCR; PNTSU; SDR20C1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DCXR; Monoclonal Antibody; DCXR (L-xylulose Reductase; XR; Carbonyl Reductase II; Dicarbonyl/L-xylulose Reductase; Kidney Dicarbonyl Reductase; kiDCR; Sperm Surface Protein P34H) (Biotin); anti-DCXR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A6
Specificity
Recognizes human DCXR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DCXR antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa145-245 from human DCXR (NP_057370) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(DCXR monoclonal antibody, Western Blot analysis of DCXR expression in A-431.)

Western Blot (WB) (DCXR monoclonal antibody, Western Blot analysis of DCXR expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DCXR on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DCXR on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1ug/ml].)
Product Categories/Family for anti-DCXR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa (264aa), confirmed by MALDI-TOF
NCBI Official Full Name
L-xylulose reductase isoform 1
NCBI Official Synonym Full Names
dicarbonyl and L-xylulose reductase
NCBI Official Symbol
DCXR
NCBI Official Synonym Symbols
XR; DCR; HCR2; P34H; HCRII; KIDCR; PNTSU; SDR20C1
NCBI Protein Information
L-xylulose reductase
UniProt Protein Name
L-xylulose reductase
UniProt Gene Name
DCXR
UniProt Synonym Gene Names
XR; kiDCR
UniProt Entry Name
DCXR_HUMAN

NCBI Description

The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal renal tubules. Defects in this gene are a cause of pentosuria. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2010]

Uniprot Description

DCXR: Catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L- xylulose. Participates in the uronate cycle of glucose metabolism. May play a role in the water absorption and cellular osmoregulation in the proximal renal tubules by producing xylitol, an osmolyte, thereby preventing osmolytic stress from occurring in the renal tubules. The enzyme defect in pentosuria has been shown to involve L-xylulose reductase. Essential pentosuria is an inborn error of metabolism characterized by the excessive urinary excretion of the pentose L-xylulose. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Oxidoreductase; Carbohydrate Metabolism - pentose and glucuronate interconversions; EC 1.1.1.10

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: microvillus; membrane; cytoplasmic microtubule; nucleus; brush border

Molecular Function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; L-xylulose reductase activity

Biological Process: glucose metabolic process; xylulose metabolic process; D-xylose metabolic process; NADP metabolic process; protein homotetramerization

Disease: Pentosuria

Research Articles on DCXR

Similar Products

Product Notes

The DCXR dcxr (Catalog #AAA6141490) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCXR (L-xylulose Reductase, XR, Carbonyl Reductase II, Dicarbonyl/L-xylulose Reductase, Kidney Dicarbonyl Reductase, kiDCR, Sperm Surface Protein P34H) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCXR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCXR dcxr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCXR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.