Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LMO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)

Rabbit LMO2 Polyclonal Antibody | anti-LMO2 antibody

LMO2 antibody - N-terminal region

Gene Names
LMO2; TTG2; LMO-2; RBTN2; RHOM2; RBTNL1
Reactivity
Dog, Guinea Pig, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LMO2; Polyclonal Antibody; LMO2 antibody - N-terminal region; anti-LMO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE
Sequence Length
158
Applicable Applications for anti-LMO2 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LMO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LMO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-LMO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)
Related Product Information for anti-LMO2 antibody
This is a rabbit polyclonal antibody against LMO2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LMO2 acts with TAL1/SCL to regulate red blood cell development. LMO2 also acts with LDB1 to maintain erythroid precursors in an immature state.LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-LMO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
rhombotin-2 isoform 1
NCBI Official Synonym Full Names
LIM domain only 2
NCBI Official Symbol
LMO2
NCBI Official Synonym Symbols
TTG2; LMO-2; RBTN2; RHOM2; RBTNL1
NCBI Protein Information
rhombotin-2
UniProt Protein Name
Rhombotin-2
Protein Family
UniProt Gene Name
LMO2
UniProt Synonym Gene Names
RBTN2; RBTNL1; RHOM2; TTG2; LMO-2
UniProt Entry Name
RBTN2_HUMAN

NCBI Description

LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]

Uniprot Description

LMO2: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Oncoprotein

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein binding; zinc ion binding; bHLH transcription factor binding; chromatin binding; cofactor binding

Biological Process: negative regulation of erythrocyte differentiation; embryonic hemopoiesis; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; mRNA transcription from RNA polymerase II promoter

Research Articles on LMO2

Similar Products

Product Notes

The LMO2 lmo2 (Catalog #AAA3224685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LMO2 antibody - N-terminal region reacts with Dog, Guinea Pig, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LMO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LMO2 lmo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGARAPEGV RAPAAGQPRA TKGAPPPPGT PPPSPMSSAI ERKSLDPSEE. It is sometimes possible for the material contained within the vial of "LMO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.