Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LMO2 expression in transfected 293T cell line by LMO2 monoclonal antibody (M07), clone 4E2.Lane 1: LMO2 transfected lysate(18.4 KDa).Lane 2: Non-transfected lysate.)

Mouse LMO2 Monoclonal Antibody | anti-LMO2 antibody

LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2) (APC)

Gene Names
LMO2; TTG2; LMO-2; RBTN2; RHOM2; RBTNL1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
LMO2; Monoclonal Antibody; LMO2 (LIM Domain only 2 (rhombotin-like 1); RBTN2; RBTNL1; RHOM2; TTG2) (APC); LIM Domain only 2 (rhombotin-like 1); TTG2; anti-LMO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
400
Specificity
Recognizes LMO2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-LMO2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LMO2 (NP_005565, 16aa-102aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LMO2 expression in transfected 293T cell line by LMO2 monoclonal antibody (M07), clone 4E2.Lane 1: LMO2 transfected lysate(18.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LMO2 expression in transfected 293T cell line by LMO2 monoclonal antibody (M07), clone 4E2.Lane 1: LMO2 transfected lysate(18.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-LMO2 antibody
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-LMO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
rhombotin-2 isoform 1
NCBI Official Synonym Full Names
LIM domain only 2
NCBI Official Symbol
LMO2
NCBI Official Synonym Symbols
TTG2; LMO-2; RBTN2; RHOM2; RBTNL1
NCBI Protein Information
rhombotin-2
UniProt Protein Name
Rhombotin-2
Protein Family
UniProt Gene Name
LMO2
UniProt Synonym Gene Names
RBTN2; RBTNL1; RHOM2; TTG2; LMO-2
UniProt Entry Name
RBTN2_HUMAN

NCBI Description

LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]

Uniprot Description

LMO2: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Oncoprotein

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein binding; zinc ion binding; bHLH transcription factor binding; chromatin binding; cofactor binding

Biological Process: negative regulation of erythrocyte differentiation; embryonic hemopoiesis; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; mRNA transcription from RNA polymerase II promoter

Research Articles on LMO2

Similar Products

Product Notes

The LMO2 lmo2 (Catalog #AAA6167031) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LMO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMO2 lmo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.